Mustela putorius furo (domestic ferret): 101672576 Help Entry 101672576         CDS       T07239                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04080   Neuroactive ligand-receptor interaction mpuf04081   Hormone signaling mpuf04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101672576 (GHRH)    04081 Hormone signaling     101672576 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101672576 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101672576 (GHRH) Cytokines and neuropeptides [BR:mpuf04052]  Neuropeptides   GPCR binding    101672576 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  101672576 NCBI-ProteinID:  XP_004746526 Ensembl:  ENSMPUG00000017763 UniProt:  M3Z239 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MLLWVFFLVILTLSSDSHSSPTSLPLRVPRNADAIFTNNYRKLLSQLSARKLLLDIMSRQ QGEENWEQGAKARLGRQVDSMWAGAKQTPLESTLAAMLQKQRNS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcactctcagcagtgactcccactcttcc ccaacgtccctgcccctcagagtccctcggaatgcagacgccatcttcacgaacaactac cggaagctgctgagccagctgtcagcccgcaagctactgctcgacatcatgagccgccag cagggagaggaaaactgggagcaaggagcaaaggcacggctcggtcgtcaggtggacagt atgtgggcaggcgcaaagcagacgcccctggagagcaccctggcggccatgttgcagaag cagaggaattcctga

DBGET integrated database retrieval system