KEGG   Mustela putorius furo (domestic ferret): 101674688
Entry
101674688         CDS       T07239                                 
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf04610  Complement and coagulation cascades
mpuf04810  Regulation of actin cytoskeleton
mpuf05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101674688
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101674688
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101674688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpuf04515]
    101674688
   04090 CD molecules [BR:mpuf04090]
    101674688
Cell adhesion molecules [BR:mpuf04515]
 Integrins
  Integrin alpha subunits
   101674688
CD molecules [BR:mpuf04090]
 Proteins
  101674688
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VWA FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 101674688
NCBI-ProteinID: XP_012901949
LinkDB
Position
Unknown
AA seq 944 aa
MLIEELAAGLFIGLWILFSDRNELFTTSKGARKDASKILIVITDGQKQGDRLGYEDVIPM
AEAAGIIRYAVGVGSAFQNQRSRKELSDIASKPSQEYIFRVENFDALRDIQNQLKEKIFA
IEGTQTISSSSFELEMSQEGFSAVITPDGPVLGAVGSFSWSGGAFLYPPNQSPTFINMSQ
ENVDMRDSYLGYSTELAFWKGVQSLILGAPRHQHTGKAVIFTKTSGKWRPKAEVAGTQIG
SYFGASLCTVDVDRDGSSDLVLIGAPHYYKPTRGGQVSVCPLPQGRAKWQCEAILFGEQG
HPWGRFGAALTVLGDVNGDKLTDVAVGAPGEQESRGAVYVFHGTSGLGISPSHSQRISAS
QLSPSLQYFGQSLSGGQDLTLDGLVDLAVGAQGQALLLRTRPVLRVWMRIQFKPAEIARS
LFECREETSSVNALGDANVCLRIYESPKNRLGDLQSSVTFDLTLDPGRQSPRAIFEETKT
RNLTRVRVLGLSQHCETVKLRLLACVEDTVTPITLRLNFSLVGKPIFSFGNLRPMLAMDA
QRYYTASLPFEKNCGTDHVCQDDLGISFGFSGLKTLLVGSTLELNMTVMVWNDGEDSYGT
TVTFFYPPGLSYRRVTESKNQLQPHSPRLTCDGNPAQGQGTQSTRCSINHLILHEGARIT
FLVTFDVSPKAMLGDRLRLAANVSSENNTPRTSKSTFQMELMVKYAIYTVISSLEQSTKY
LNFSASDQEESSQAQHKYQVNNLGQRDLPISIIFSVPVKLNGVPVWTQLEVFHPQNPSIQ
CSSERIVHTKSDFLTKNQKSYVLDCSIADCLRFCCDLPSFGIQEELDFILKGNISFGWVS
QTLQKKVSVVSVAEITFNRSVYSQLPGQEAFLRAQMETVLEKYEVYNPIPIIVGSSVGGL
LLLALITAVLYKVGFFKRQYKEMMAEASGQTVPEHGTSDPQVAQ
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgttgatagaggagctagcggcaggcctgttcataggtctctggatccttttctctgac
agaaacgaactgttcactacctcaaaaggagcccgaaaagatgcctccaagatcctcatt
gtcatcacagatgggcaaaaacaaggcgaccgcctgggttatgaggatgtcatccctatg
gctgaggctgcgggcatcatccgctatgcagttggggtgggatcagcttttcaaaaccaa
cgttcccggaaagaattaagtgacattgcatcgaagccctcacaggagtacatttttaga
gtggagaattttgatgctttgagagacattcaaaaccaactaaaagagaagatctttgcc
attgagggtacgcagaccataagcagtagttcctttgaactggagatgtcccaggagggc
ttcagtgctgtgatcacacctgatggaccagttctgggggcagtggggagcttcagctgg
tctggaggtgccttcctgtaccccccaaaccaaagtcccactttcatcaacatgtctcaa
gagaatgtggacatgagggactcttacctgggttactccactgagctggccttttggaag
ggggtccagagcctgatcctgggggccccccgccatcagcatactgggaaggctgtcatc
ttcaccaagacgtctgggaaatggaggccgaaggctgaagtcgcagggactcagatcggc
tcttactttggggcctccctctgcactgtggatgtggatagagatggcagctctgacctt
gtcctcatcggggctcctcattactacaagccaacccgaggggggcaggtgtctgtgtgc
cccttgccccaggggagggctaagtggcaatgtgaggccattctctttggggagcaaggc
cacccctggggccgctttggggcagcgctgacagtgctgggggatgtgaatggggacaag
ctgacagacgtggccgtcggggccccaggagagcaggagagccggggtgctgtctatgtc
tttcatggaacctcagggctgggcatcagcccctcccacagtcagaggatctcagcctcc
cagctctctcccagcctccagtattttgggcaatcactgagtgggggccaagaccttacc
ctggatggactggtggacctggccgtgggggcccagggacaggcgctgctgctcaggacc
agacctgtactcagggtgtggatgcgaatccaattcaaacctgcagagatagccaggtct
ctgtttgagtgtcgggaagagacctcctctgtcaacgcactgggtgatgctaatgtctgt
cttcgtatttatgaaagtcccaagaatcgactgggtgacctccaaagctctgtgaccttt
gacctaaccctcgaccctggccgccagagtccccgtgccatctttgaggagacaaaaaca
cggaatctgactcgtgtccgagtccttgggctgagtcaacactgtgagactgtgaagttg
cgtctcctggcctgcgtggaggacacggtgacccccatcaccttgcgtctcaacttctcc
ctggtgggcaagcctatattttcctttggaaatctccggcctatgttggctatggatgct
cagagatattacacagcctctctcccctttgagaagaattgtggaactgaccatgtctgt
caggatgaccttggcatctcctttggcttctcaggcttgaagaccctgttggtggggagt
accctggagctgaatatgacagtgatggtgtggaatgatggtgaggactcctatggaacc
acagtcaccttcttctaccctccagggttgtcttatcgacgtgtgacagagagcaagaac
cagctgcagccacactccccacgcctgacctgtgatggcaacccagcccagggccagggt
actcagagcactcgctgcagcatcaaccacctcatcctccatgagggtgcccggatcact
ttcctggtcacctttgatgtctcccccaaggccatgctcggggaccggctgcgtctggcg
gctaatgtgagcagtgaaaataacactcccaggaccagcaagagcacctttcagatggag
ctcatggtgaagtatgccatctacaccgtgattagcagccttgaacagtccactaagtac
ctcaacttctcagcctcagaccaggaggaaagcagccaagctcagcataaataccaggtg
aacaacttgggacagagggacctgcctatcagcatcatcttctctgtgcctgtgaagctg
aatggggtacctgtgtggacacaattagaggtcttccacccccagaatccctccattcag
tgctcttcagagagaatagttcacacaaagtctgacttcctgaccaaaaatcagaagagt
tatgtgctggactgctccattgctgactgtctgaggttctgttgtgacctcccttccttt
ggcatccaggaggaacttgacttcatcctgaagggcaacatcagttttggttgggtcagc
cagacattgcagaagaaggtatctgtggtgagtgtggctgaaatcacgttcaacagatcc
gtgtattcccagcttccaggacaggaggcattcttgagagctcagatggagacggtgctg
gagaagtatgaggtctacaatcctatccccatcattgtgggcagctctgtgggaggactg
ctgctgttggctctcatcacagccgtcctgtacaaggttggcttcttcaagcgtcagtat
aaagaaatgatggcagaagcaagtggacagactgtcccagaacatgggacttctgaccct
caagttgcccaataa

DBGET integrated database retrieval system