Muntiacus reevesi (Reeves' muntjac): 136147215 Help Entry 136147215         CDS       T10466                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01521   EGFR tyrosine kinase inhibitor resistance mree01522   Endocrine resistance mree04010   MAPK signaling pathway mree04012   ErbB signaling pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04062   Chemokine signaling pathway mree04068   FoxO signaling pathway mree04071   Sphingolipid signaling pathway mree04072   Phospholipase D signaling pathway mree04137   Mitophagy - animal mree04140   Autophagy - animal mree04150   mTOR signaling pathway mree04151   PI3K-Akt signaling pathway mree04210   Apoptosis mree04211   Longevity regulating pathway mree04213   Longevity regulating pathway - multiple species mree04218   Cellular senescence mree04360   Axon guidance mree04370   VEGF signaling pathway mree04371   Apelin signaling pathway mree04540   Gap junction mree04550   Signaling pathways regulating pluripotency of stem cells mree04625   C-type lectin receptor signaling pathway mree04650   Natural killer cell mediated cytotoxicity mree04660   T cell receptor signaling pathway mree04662   B cell receptor signaling pathway mree04664   Fc epsilon RI signaling pathway mree04714   Thermogenesis mree04720   Long-term potentiation mree04722   Neurotrophin signaling pathway mree04725   Cholinergic synapse mree04726   Serotonergic synapse mree04730   Long-term depression mree04810   Regulation of actin cytoskeleton mree04910   Insulin signaling pathway mree04912   GnRH signaling pathway mree04915   Estrogen signaling pathway mree04916   Melanogenesis mree04917   Prolactin signaling pathway mree04919   Thyroid hormone signaling pathway mree04921   Oxytocin signaling pathway mree04926   Relaxin signaling pathway mree04929   GnRH secretion mree04933   AGE-RAGE signaling pathway in diabetic complications mree04935   Growth hormone synthesis, secretion and action mree05010   Alzheimer disease mree05022   Pathways of neurodegeneration - multiple diseases mree05034   Alcoholism mree05160   Hepatitis C mree05161   Hepatitis B mree05163   Human cytomegalovirus infection mree05165   Human papillomavirus infection mree05166   Human T-cell leukemia virus 1 infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05170   Human immunodeficiency virus 1 infection mree05200   Pathways in cancer mree05203   Viral carcinogenesis mree05205   Proteoglycans in cancer mree05206   MicroRNAs in cancer mree05207   Chemical carcinogenesis - receptor activation mree05208   Chemical carcinogenesis - reactive oxygen species mree05210   Colorectal cancer mree05211   Renal cell carcinoma mree05213   Endometrial cancer mree05214   Glioma mree05215   Prostate cancer mree05216   Thyroid cancer mree05218   Melanoma mree05219   Bladder cancer mree05220   Chronic myeloid leukemia mree05221   Acute myeloid leukemia mree05223   Non-small cell lung cancer mree05224   Breast cancer mree05225   Hepatocellular carcinoma mree05226   Gastric cancer mree05230   Central carbon metabolism in cancer mree05231   Choline metabolism in cancer mree05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136147215 (NRAS)    04012 ErbB signaling pathway     136147215 (NRAS)    04014 Ras signaling pathway     136147215 (NRAS)    04015 Rap1 signaling pathway     136147215 (NRAS)    04370 VEGF signaling pathway     136147215 (NRAS)    04371 Apelin signaling pathway     136147215 (NRAS)    04068 FoxO signaling pathway     136147215 (NRAS)    04072 Phospholipase D signaling pathway     136147215 (NRAS)    04071 Sphingolipid signaling pathway     136147215 (NRAS)    04151 PI3K-Akt signaling pathway     136147215 (NRAS)    04150 mTOR signaling pathway     136147215 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136147215 (NRAS)    04137 Mitophagy - animal     136147215 (NRAS)   09143 Cell growth and death    04210 Apoptosis     136147215 (NRAS)    04218 Cellular senescence     136147215 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     136147215 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     136147215 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136147215 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136147215 (NRAS)    04650 Natural killer cell mediated cytotoxicity     136147215 (NRAS)    04660 T cell receptor signaling pathway     136147215 (NRAS)    04662 B cell receptor signaling pathway     136147215 (NRAS)    04664 Fc epsilon RI signaling pathway     136147215 (NRAS)    04062 Chemokine signaling pathway     136147215 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     136147215 (NRAS)    04929 GnRH secretion     136147215 (NRAS)    04912 GnRH signaling pathway     136147215 (NRAS)    04915 Estrogen signaling pathway     136147215 (NRAS)    04917 Prolactin signaling pathway     136147215 (NRAS)    04921 Oxytocin signaling pathway     136147215 (NRAS)    04926 Relaxin signaling pathway     136147215 (NRAS)    04935 Growth hormone synthesis, secretion and action     136147215 (NRAS)    04919 Thyroid hormone signaling pathway     136147215 (NRAS)    04916 Melanogenesis     136147215 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     136147215 (NRAS)    04726 Serotonergic synapse     136147215 (NRAS)    04720 Long-term potentiation     136147215 (NRAS)    04730 Long-term depression     136147215 (NRAS)    04722 Neurotrophin signaling pathway     136147215 (NRAS)   09158 Development and regeneration    04360 Axon guidance     136147215 (NRAS)   09149 Aging    04211 Longevity regulating pathway     136147215 (NRAS)    04213 Longevity regulating pathway - multiple species     136147215 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     136147215 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136147215 (NRAS)    05206 MicroRNAs in cancer     136147215 (NRAS)    05205 Proteoglycans in cancer     136147215 (NRAS)    05207 Chemical carcinogenesis - receptor activation     136147215 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     136147215 (NRAS)    05203 Viral carcinogenesis     136147215 (NRAS)    05230 Central carbon metabolism in cancer     136147215 (NRAS)    05231 Choline metabolism in cancer     136147215 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136147215 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     136147215 (NRAS)    05225 Hepatocellular carcinoma     136147215 (NRAS)    05226 Gastric cancer     136147215 (NRAS)    05214 Glioma     136147215 (NRAS)    05216 Thyroid cancer     136147215 (NRAS)    05221 Acute myeloid leukemia     136147215 (NRAS)    05220 Chronic myeloid leukemia     136147215 (NRAS)    05218 Melanoma     136147215 (NRAS)    05211 Renal cell carcinoma     136147215 (NRAS)    05219 Bladder cancer     136147215 (NRAS)    05215 Prostate cancer     136147215 (NRAS)    05213 Endometrial cancer     136147215 (NRAS)    05224 Breast cancer     136147215 (NRAS)    05223 Non-small cell lung cancer     136147215 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136147215 (NRAS)    05170 Human immunodeficiency virus 1 infection     136147215 (NRAS)    05161 Hepatitis B     136147215 (NRAS)    05160 Hepatitis C     136147215 (NRAS)    05163 Human cytomegalovirus infection     136147215 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     136147215 (NRAS)    05165 Human papillomavirus infection     136147215 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     136147215 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     136147215 (NRAS)   09165 Substance dependence    05034 Alcoholism     136147215 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136147215 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     136147215 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136147215 (NRAS)    01522 Endocrine resistance     136147215 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136147215 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136147215 (NRAS)    04031 GTP-binding proteins [BR:mree04031]     136147215 (NRAS) Membrane trafficking [BR:mree04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     136147215 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     136147215 (NRAS) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136147215 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    136147215 (NRAS)   Exosomal proteins of breast cancer cells    136147215 (NRAS)   Exosomal proteins of colorectal cancer cells    136147215 (NRAS) GTP-binding proteins [BR:mree04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     136147215 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  136147215 NCBI-ProteinID:  XP_065762575 LinkDB All DBs Position 1:90801777..90811899 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgagacctgtctgttggacatactggacacagctgga caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctttgt gtgtttgccatcaataacagcaagtcatttgcagacattaacctctacagggaacagatt aagcgcgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactgaacagcagtgatgatggcactcaaggc tgtatggggttgccgtgtgtggtaatgtaa

DBGET integrated database retrieval system