KEGG   Mauremys reevesii (Reeves's turtle): 120386124
Entry
120386124         CDS       T07797                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mrv  Mauremys reevesii (Reeves's turtle)
SSDB
Motif
Pfam: MRAP FixQ DUF6097
Other DBs
NCBI-GeneID: 120386124
NCBI-ProteinID: XP_039360963
LinkDB
Position
1:complement(169353934..169371266)
AA seq 123 aa
MAIRTNSSEYYWSYEYYWDYLDPVPVDERKLKANKYSIVIAFWVGLAAFVVFLFLILLYM
SRSGSTSVKQVLAGNRIEHLEGSSSNAERLHCDDLSSPDSDLIATEPRNSLSDETGIHGR
ISA
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctatcagaacaaactcatctgagtattattggtcttatgaatattactgggactat
ttggatccagttcctgtagatgaaaggaagttgaaggctaataaatattcaattgtcata
gccttttgggttgggcttgctgcatttgtggtgtttctgttccttatattgctctacatg
tcccgatctgggtcaacatcagtcaaacaagtgcttgcaggtaaccggatagaacatctg
gaaggaagtagctccaatgctgagcggctgcattgtgatgatctcagcagtccggactca
gacttgatcgctactgaaccacgtaattctctttcagatgaaactggcattcatggaagg
atctcagcttga

DBGET integrated database retrieval system