KEGG   Mauremys reevesii (Reeves's turtle): 120395034
Entry
120395034         CDS       T07797                                 
Name
(RefSeq) integrin alpha-X-like
Organism
mrv  Mauremys reevesii (Reeves's turtle)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 FG-GAP_2
Other DBs
NCBI-GeneID: 120395034
NCBI-ProteinID: XP_039375161
LinkDB
Position
Unknown
AA seq 628 aa
MYYTTLNGGRVYICQINLPGMTMVCNKTLHGQTGEVSGRFGASMSEIGDISGDGQTDVAI
GAPMENDNHGALYIFHGEKGGLSPQYRQRIVGSQFPSRLHYFGQAVSGGTDLTGDGLPDI
AVGAQGQVLLLRSRPVLRVGVSISFQPPTIPTSAFDCQGQEQLNTEASRAEVCFTVTKST
KDSLGDRISSIIQYSLALDPGRTKIRVTFDSTGPVLSRELQLGIEKKCETYRIMLPLCPE
DILTPITLRLSYTLTGEPIAAAGRLRPILSEDSVPVSAGSLPFQKDCGTDGRCDDQLAVS
FNFSGLSTLVVGITPELNTTVSIQNHGENSYSTTVQFFYPAALSYRRVLLLQSNRRAMAI
KCSSAEGSEELSQRNSICHINHPIFWSGAEAVFVATFDVSSEADLGDSLQITAKASSDNG
GPITKRMMHRAELPVKYGIFIILTSLKESTKYIKFSSKEAGTSVPVTHRYKVKNLRQRSV
PISVTFQFPVELSGVRVWDASEVVPSKPHLAQCTSEADMPGSKDFVKQMSKRPLLDCSVA
TCKKIRCRIASLEMQQPLEFVIKGNVSFQWVSQTQLQKVSLVSKARIEYEKKKYTQKEGI
VQRQVQTVVERSKVYNYLPISVGSSVGA
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgtactatacaactctgaatggaggacgggtctatatctgccagattaacttgccgggg
atgacgatggtctgcaacaagacactacatgggcagacgggggaagtgtctgggcgcttt
ggggccagcatgtctgaaatcggggacatcagcggggacggacagacggacgtggccatc
ggggctcccatggagaatgacaatcatggggccttgtacatcttccatggggaaaaggga
ggcctcagtccccagtacagacagcgcatagtggggtcacagtttcccagcaggctgcac
tactttggccaggctgtcagtggcgggacagatctgacgggggatgggctgccggacatc
gcggtgggggcacaagggcaggtcctgctgctgaggtcccggccggtgctcagagtcggg
gtctccatcagcttccagcctccaaccatcccaacctcggccttcgactgccaggggcag
gagcagctcaacacggaggccagcagggcagaggtctgcttcaccgtcactaagagcacc
aaggacagcttaggtgacaggatctccagcatcatccagtacagcctggccctggaccct
gggcggacgaagatccgagtcaccttcgactccaccggccccgtcctgagcagggagctg
cagctcggcattgagaagaaatgtgagacgtaccggataatgttgcctctctgtcccgaa
gacattctgacccccatcaccctgcgccttagctacaccctgacgggggagcccatcgct
gccgccggccgcctcagacccatcctgagcgaggactctgtgccggtgtctgcaggctcg
ctcccgtttcagaaggactgcggcacggatggccgctgcgatgaccagttagcagtctcc
ttcaatttctctggcttgagcaccctggtggtggggatcacccctgaactcaacaccacc
gtctccatccagaaccacggggagaattcctacagcaccacggtgcagttcttctacccg
gccgcgctgtcctaccgccgggtgctgctgctccagtctaacaggagggccatggccatt
aagtgcagctcggcggagggctcggaggagctatctcaaaggaacagcatctgccacatc
aaccaccccatcttctggagcggggccgaggccgttttcgtcgccaccttcgacgtctcc
tctgaggccgacctgggtgacagcctgcagatcacggccaaggccagcagtgacaatggc
ggccccatcaccaagcgcatgatgcaccgggcggagctgccggtcaagtacggcatcttc
atcatcctcaccagccttaaggagtcgaccaagtacattaaattctcctccaaggaggca
gggacaagtgtgccagtgacacatcggtacaaggtcaagaacctgcggcagcgaagcgtc
cccatctcggtcacgttccagttccccgtggagctgagcggggtccgggtgtgggacgcc
tctgaggtcgtcccctccaagccccacctggctcagtgcaccagtgaggctgacatgccg
ggttcgaaggactttgtgaagcagatgagcaagcgccccctgctggactgctccgtggcc
acctgtaagaagatccggtgcagaattgcctccctggaaatgcagcagccactggagttc
gtgatcaaagggaacgtcagcttccagtgggtctcccagactcagctgcagaaagtgagt
ctggtgagcaaggcccggattgaatacgagaagaagaaatacacccagaaggagggaatc
gtccagcgccaggtgcagacggtggtggagcgctccaaggtctataactacctgcctatc
agtgtgggcagcagcgtgggagcctga

DBGET integrated database retrieval system