Marinobacterium rhizophilum: KDW95_21395 Help Entry KDW95_21395       CDS       T08609                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mrz  Marinobacterium rhizophilum Pathway mrz02024   Quorum sensing mrz03018   RNA degradation Brite KEGG Orthology (KO) [BR:mrz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KDW95_21395 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KDW95_21395 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mrz03019]     KDW95_21395 (hfq)    03036 Chromosome and associated proteins [BR:mrz03036]     KDW95_21395 (hfq) Messenger RNA biogenesis [BR:mrz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KDW95_21395 (hfq) Chromosome and associated proteins [BR:mrz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KDW95_21395 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UTW11775 UniProt:  A0ABY5HHE5 LinkDB All DBs Position 4751247..4751486 Genome browser AA seq 79 aa AA seqDB search MSKGQSLQDPYLNVLRKERVPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARPVKLPQADEKQPD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcagtctttacaagacccttatctaaacgttctgcgcaaggagcgtgtg ccggtttcgattttcctggtgaatggtatcaagctgcagggacagatcgagtctttcgat cagttcgtgattctgcttaagaataccgtcagccagatggtctacaagcatgcgatatct acagtcgttcctgcccgtccggtgaaactgccgcaggccgacgagaagcagccggactga

DBGET integrated database retrieval system