Micropterus salmoides (largemouth bass): 119888918 Help Entry 119888918         CDS       T07309                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism msam  Micropterus salmoides (largemouth bass) Pathway msam04010   MAPK signaling pathway msam04068   FoxO signaling pathway msam04081   Hormone signaling msam04114   Oocyte meiosis msam04140   Autophagy - animal msam04150   mTOR signaling pathway msam04810   Regulation of actin cytoskeleton msam04910   Insulin signaling pathway msam04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:msam00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119888918 (insb)    04068 FoxO signaling pathway     119888918 (insb)    04150 mTOR signaling pathway     119888918 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     119888918 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119888918 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     119888918 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119888918 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     119888918 (insb)    04914 Progesterone-mediated oocyte maturation     119888918 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:msam04052]     119888918 (insb) Cytokines and neuropeptides [BR:msam04052]  Neuropeptides   Unclassified    119888918 (insb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  119888918 NCBI-ProteinID:  XP_038555639 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MARVPWAASILLLLVLHSPGVTSAPTQHLCGSHLVDALYFVCGERGFFYSSNRPHKRDLE HLLGILSKRARQEQRLWRALSGHEEPKVKRGIVEQCCHKPCSIYHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatgggcagcgtccatcctgttactgctggtgctccactctcctggg gtgacctcggctcccacccagcacctgtgtggctcccacctggtggacgccctctacttc gtatgtggagaacggggctttttctacagttcaaaccgaccccacaagcgggatctcgaa catctgcttgggatcctgtccaaaagggccagacaggagcagcggctgtggagggctctg tctggccacgaagagcccaaggtgaagagaggcatcgtggagcagtgctgccataagcca tgcagcatttaccacctggagggatactgcgactga

DBGET integrated database retrieval system