Mycobacteroides saopaulense: MYCSP_16700 Help Entry MYCSP_16700       CDS       T05445                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism msao  Mycobacteroides saopaulense Pathway msao00074   Mycolic acid biosynthesis msao00280   Valine, leucine and isoleucine degradation msao00630   Glyoxylate and dicarboxylate metabolism msao00640   Propanoate metabolism msao01100   Metabolic pathways msao01110   Biosynthesis of secondary metabolites msao01120   Microbial metabolism in diverse environments msao01200   Carbon metabolism Module msao_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA msao_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:msao00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     MYCSP_16700    00640 Propanoate metabolism     MYCSP_16700   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     MYCSP_16700   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MYCSP_16700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Pput2613-deam Motif Other DBs NCBI-ProteinID:  ALR12767 LinkDB All DBs Position 3384855..3385157 Genome browser AA seq 100 aa AA seqDB search MTNEEGASVTDETSETVTTEADSGKVKAADVQVLSGNPTDEEIAALVAALSALASKSEAA DLKPRNLWAEPIDMLRYSPQSWQRVTLFERAKLARPQGSY NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtgacgaatgaagaaggtgcgtccgtgaccgacgagaccagcgagaccgtaaccaccgaa gccgattccgggaaggtcaaggctgccgacgtgcaggtgctcagcggcaacccaaccgat gaggagatcgcggcgctggtcgcggcgctcagcgcgctggcctccaagtccgaggccgcc gacctcaaaccccggaacctctgggccgagccgatcgacatgctgcgctacagcccacag agctggcagcgggtcacgctcttcgagcgcgccaagctggctcgcccgcagggttcttac taa

DBGET integrated database retrieval system