Mycolicibacterium sediminis: MSEDJ_27080 Help Entry MSEDJ_27080       CDS       T07629                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism msei  Mycolicibacterium sediminis Pathway msei00074   Mycolic acid biosynthesis msei00280   Valine, leucine and isoleucine degradation msei00630   Glyoxylate and dicarboxylate metabolism msei00640   Propanoate metabolism msei01100   Metabolic pathways msei01110   Biosynthesis of secondary metabolites msei01120   Microbial metabolism in diverse environments msei01200   Carbon metabolism Module msei_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA msei_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:msei00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     MSEDJ_27080    00640 Propanoate metabolism     MSEDJ_27080   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     MSEDJ_27080   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MSEDJ_27080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  BBY28612 UniProt:  A0A7I7QQX5 LinkDB All DBs Position complement(2785322..2785603) Genome browser AA seq 93 aa AA seqDB search MSQDIDITELSDPRDMTIDAPVDDSVAVFRVEKGNPTVEELAALVTVLGGARGGPAEPGP QELNPWGHPVDKLRYTVFSWQLVTLLERTHMRR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtgtcccaggacatcgacatcaccgaactgagcgacccgcgcgacatgacgatcgacgcg ccggtcgacgactcggtcgcggtgttccgcgtcgagaagggcaatccgacggtcgaggaa ttggccgcgctggtgacggtgctcggcggcgcccgcggcggacccgccgaaccgggcccg caggaactgaacccctggggccacccggtcgacaagttgcggtacacggtgttcagctgg cagttggtcacactgctggaacggacgcacatgcggcgatga

DBGET integrated database retrieval system