KEGG   Metabacillus sediminilitoris: GMB29_12010
Entry
GMB29_12010       CDS       T07731                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
msem  Metabacillus sediminilitoris
Pathway
msem00780  Biotin metabolism
msem01100  Metabolic pathways
msem01240  Biosynthesis of cofactors
Module
msem_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:msem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GMB29_12010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:msem00199]
    GMB29_12010
Enzymes [BR:msem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     GMB29_12010
Cytochrome P450 [BR:msem00199]
 Cytochrome P450, bacteria type
  CYP107 family
   GMB29_12010
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QGQ45891
LinkDB
Position
2527377..2528585
AA seq 402 aa
MKTDVNQTISHSLISTEFFQNPYPFYEELRSIHSICWGNLVKNPGWYVTGYDEAITILKD
TRFQNRIPLPQTSKKYECLKNIQHDMMLFKNQPDHKRLRFMVSNVFTPRMVEYLRPFIHE
TVNDLLHQFQHKKSMDVVSDFAFPLASLIIAKIIGVPQEERYQFKKWSADLIQTIDFTRS
RTTLDNGNEMTIILRDYFKGLIKKRKNSPEEDLISLLIKAEQIGDRLTDEEVIATCILLV
IAGHETTVNLISNSILTLLNHPQQLMELKEKSFLIEGAVEEFLRFESPTQMTARIASEDI
KINQTTIKKGNQVYILLGAANRDPNKFQDAHLFDIMRDPNPHLAFGYGSHFCLGAPLARL
EAQIAIKSLLAWKDNLQLAASDLQWRKLIGFRSLSELHITFD
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaaaacagatgtcaatcaaaccatttcgcattcacttatatctactgagttttttcaa
aacccttatccattttatgaagagcttcgatccatacactcgatttgttgggggaatttg
gtgaaaaatccaggctggtacgtaactggatatgatgaggcaataacgattcttaaagat
actcgatttcaaaatcgcatcccgttaccacagacatcaaaaaaatatgagtgcctaaaa
aacatacaacatgacatgatgctttttaaaaatcagcccgaccataagcgattacgtttc
atggttagtaacgtatttacaccgagaatggtagagtatctacgaccttttatccacgaa
acagtaaatgatttgcttcaccagtttcaacataagaaatcaatggatgtcgtttcagac
ttcgcgtttcctttagctagtctcattattgcgaaaataataggagtgccacaagaagag
cgatatcaatttaaaaaatggtcggcagacttaattcaaaccattgattttactcgttcg
agaacgacgttagacaatggaaatgaaatgacaatcatcttaagggactattttaaagga
ctgattaaaaaacggaaaaacagccctgaagaagatcttatcagcttgttaataaaagcg
gaacagattggggataggttaactgacgaggaagtaatcgcaacttgcattttacttgta
attgctggtcatgagacaaccgttaatcttattagcaattcaatccttaccttattgaat
catccacagcaattaatggagctaaaggaaaaatcctttctgattgaaggggcggttgag
gagtttctacgctttgaaagtccaacacaaatgactgctcggattgcttcggaggatata
aagatcaatcaaacaacgattaaaaaaggtaatcaagtatatattctgctgggtgctgca
aatcgtgatccaaataaatttcaagatgcccatttatttgacataatgagggacccgaat
ccccatcttgcatttggatatggctcacatttttgtttaggggccccactcgcacgacta
gaagctcaaattgcgattaaatcactactagcttggaaagacaaccttcaattagctgca
tctgacttgcaatggagaaaactgattggatttagatcgttatctgaacttcacattaca
tttgactga

DBGET integrated database retrieval system