KEGG   Manduca sexta (tobacco hornworm): 115442696
Entry
115442696         CDS       T07401                                 
Name
(RefSeq) methylenetetrahydrofolate reductase
  KO
K25009  methylenetetrahydrofolate reductase [NAD(P)H] [EC:1.5.1.20]
Organism
msex  Manduca sexta (tobacco hornworm)
Pathway
msex00670  One carbon pool by folate
msex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    115442696
Enzymes [BR:msex01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     115442696
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-GeneID: 115442696
NCBI-ProteinID: XP_030023693
LinkDB
Position
11:complement(6988673..6990483)
AA seq 270 aa
MVPGIKIIDLIKQSETFSFSFEVSPGITEEVINNLEVEPKFFAVTWHAKTHKCKDLDIEP
LRKAIFLRSKQQNVLLHLSCDLLRKPYLDDLITLLQAHGICNLFIVLGEGYDPSTSDFQN
SSELIKYIKEKSGNYFCIGTAGFLESSEERIIQLKEKIAIGADFIMTQAFFEVSLFSAFL
EKCKKADINVPVLPGIYAFENYTQLDKFINLCKVKVSSDVLEKVKNNIDGVELTKNLIRS
IYSDLNCTHFHFFSLNNLGGTIHLIKQLQF
NT seq 813 nt   +upstreamnt  +downstreamnt
atggtgcctggaataaaaatcatcgacttaataaaacagagcgaaacattttcattttca
ttcgaagtatcgcctggcataacagaagaagtaatcaataatttggaagttgaaccaaag
ttttttgcggtcacttggcatgcgaaaacacacaaatgtaaggatcttgacatcgaacca
ttacgaaaagctattttcttacgaagtaagcagcaaaatgtattgttacatttatcgtgt
gacttgctcagaaaaccatacttggatgatttgataacattgcttcaagcacatggaata
tgtaatttgtttattgtgttgggagagggatacgacccgagtacgtcagatttccaaaac
agttccgaactaataaaatatattaaagaaaaatctggaaattatttctgtatcggcacc
gctggtttccttgaaagttcagaagaaagaatcattcaattgaaagaaaaaattgcaatc
ggagcagactttattatgacacaggctttctttgaagttagcttattcagcgcgtttttg
gaaaaatgcaagaaagctgatataaatgtgccagtattacccggtatatacgcttttgaa
aattatacacaattggacaaattcataaatttgtgtaaagttaaagtttcaagtgatgta
ctagaaaaagtaaaaaataacatagatggtgtagagttaaccaagaatttaatacggtcg
atatattctgatttgaactgtactcattttcatttcttttcattaaataatctgggagga
accattcatttgattaaacagttgcaattttaa

DBGET integrated database retrieval system