KEGG   Manduca sexta (tobacco hornworm): 115443466
Entry
115443466         CDS       T07401                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
msex  Manduca sexta (tobacco hornworm)
Pathway
msex00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:msex00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    115443466
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:msex00199]
    115443466
Enzymes [BR:msex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     115443466
Cytochrome P450 [BR:msex00199]
 Cytochrome P450, animal type
  CYP306 family
   115443466
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 115443466
NCBI-ProteinID: XP_030024739
LinkDB
Position
17:8893136..8901070
AA seq 537 aa
MDLFFIWLVTFVAGFWICKKIKEWQNLPPGPWGLPILGYLPFIDPRQPHITLTKLSKLYG
PIYGLKMGNIYAVVLSDHKLIRDAFAKENFSGRAPLYLTHGIMHGNGIICAEGGLWKDQR
KLITTWLKSFGMSKHSALRDKLEKRIASGVYELLDSIEKSPKEPIDLPHMVSNSLGNVVN
EIIFGFKFPSDDKTWQWLRQIQEEGCHEMGVAGVVNFLPFVRFFSPTIRKTIQMLIRGQA
QTHTLYASVIARRRNMLGLEKPKGAEHLPHSNLFNEYPDGKLKCIKYSKHAPNTEHIFDP
KTLIPTEGECILDSFLLEQKKRFENGDETARYMTDEQLHFLLADMFGAGLDTTSVTLAWF
LLYMALYPDEQEIVRKEILSEYPEECEVESSRLPRLMAAIYETQRIRSIVPVGIPHGCLE
DTYLGNYKIPKGAMVIPLQWALHMDPDVWEDSEEFKPSRFLAPDGSLLKPQEFIPFQTGK
RMCPGDELSRMLASGFIARLFRRKRVRLASIPSQEDMQGTVGVTLAPPRVQYFCDPI
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggacctcttctttatatggttggtaacattcgtggcaggattttggatttgcaaaaaa
ataaaagaatggcaaaatttacctcctggaccttggggcttacctatattgggctacctg
cccttcatcgaccctcgtcagccccacattacattaacaaaattatccaaactatatggc
cccatctatggattgaaaatgggaaatatttatgccgttgttttatctgatcacaaactc
ataagagatgcctttgccaaagaaaacttctcaggacgagcacccttgtatctgactcat
ggaattatgcatgggaatggtatcatctgcgctgagggagggctttggaaagaccagagg
aaattgatcacgacttggctgaaaagttttggaatgagcaaacatagtgcattacgagat
aagttggaaaaacgaatagcgtctggtgtttacgaattgcttgatagtatagaaaaatca
ccaaaagaaccaatagatctacctcacatggtatctaattcgcttggaaatgtagtcaat
gaaattattttcggctttaaatttccctccgacgacaagacttggcaatggttacgacaa
atacaagaagaggggtgtcatgagatgggtgtcgctggcgttgtgaatttcttgccgttt
gtaagatttttctcgccaactattagaaaaacgattcaaatgttaattcgcggtcaagcg
caaactcatactctatatgcaagcgttatagcgaggcgtcgtaatatgttggggttggag
aaacccaagggagccgagcacctgccacacagcaatctgttcaacgaatacccagacggc
aaacttaaatgtataaaatatagcaagcatgcgccgaacacagagcacatcttcgatcca
aaaactctcattcccactgaaggcgaatgcatattggacagttttttgttggaacaaaag
aaaaggttcgagaatggcgatgagactgcgcggtatatgacagacgaacaacttcatttt
ctgttggccgatatgtttggcgccggcttggacaccacgtcagtcacacttgcctggttc
ttgttatatatggccttataccctgatgaacaggaaatcgttcgcaaagaaattctatcg
gaatacccagaagaatgtgaagtggagagctcacgactaccgcgtctcatggcagctatt
tatgagactcagcgaatacgatccattgtacccgtcggcatacctcatggatgtttggag
gatacatatctcggcaattacaaaattccgaaaggtgctatggtaatacctctgcagtgg
gccttacacatggatccggatgtgtgggaagactcggaggaattcaaaccgagtaggttc
ctagcgccggacggtagcttgctaaaaccgcaagagttcataccttttcaaacaggtaaa
cgtatgtgccccggcgatgagctctctcggatgctggcgagcggctttattgctcgtttg
ttccgccgtaaacgtgtccgtctggcttctataccatctcaggaagatatgcaagggacc
gtcggagtcacgctggcgcccccgcgtgttcaatatttctgcgacccaatatga

DBGET integrated database retrieval system