Mycolicibacterium smegmatis MC2 155: MSMEI_2607 Help Entry MSMEI_2607        CDS       T02191                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism msg  Mycolicibacterium smegmatis MC2 155 Pathway msg00670   One carbon pool by folate msg00790   Folate biosynthesis msg01100   Metabolic pathways msg01240   Biosynthesis of cofactors msg04981   Folate transport and metabolism Module msg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:msg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MSMEI_2607 (folA)    00670 One carbon pool by folate     MSMEI_2607 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     MSMEI_2607 (folA) Enzymes [BR:msg01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      MSMEI_2607 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 DUF7912 Motif Other DBs NCBI-ProteinID:  AFP39075 UniProt:  I7FC10 Structure PDBPDBj LinkDB All DBs Position 2751979..2752449 Genome browser AA seq 156 aa AA seqDB search MSMRLIWAQSTSGIIGRDNSIPWRLPEDLARFKEMTMGHPVVMGRLTWESLPASVRPLPG RRNIVVTRDADYRAEGAEVVTDLPDEPDAWVIGGAQIYAMALARADRCEVTEVDIALTPL DGDARAPVLDDSWVATTGEWQTSTSGLRFRFCSYRR NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgagtatgagactgatctgggcccagtcgacctcagggatcatcggccgggacaactcc attccatggcgtctgcccgaggacctcgcccggttcaaggagatgaccatgggccatccg gtggtgatgggacggctcacgtgggagtcgctgcctgcctcggtgcgcccgctgccgggg cgccgcaacatcgtcgtgacccgtgacgccgactaccgggccgagggcgccgaggtggtc accgacctgcccgacgaacccgatgcgtgggtgatcggcggcgcccagatctatgcgatg gcactggcgcgggccgaccgctgtgaggtcaccgaggtcgacatcgccctgacgccactc gacggtgatgcgcgcgcaccggtgctcgacgactcgtgggtcgcgacgacgggtgagtgg cagaccagtacgtcaggcctgcgtttccggttctgcagctaccggcgctga

DBGET integrated database retrieval system