KEGG   Methylocella silvestris: Msil_2640
Entry
Msil_2640         CDS       T00802                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
msl  Methylocella silvestris
Pathway
msl00790  Folate biosynthesis
msl01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Msil_2640
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     Msil_2640
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: ACK51563
UniProt: B8EQ73
LinkDB
Position
2887683..2888078
AA seq 131 aa
MADVRVICAIGRRGQLGLDGRLPWEGNPGREYKADVARFFDLTRGHVLIAGPRTIASFPD
WARPERTLVAVRSSDEPEEVIGRFPGRVIFIGGGPPVWSAYARFVMHWDVTKLPYDGEAD
RYLDPAWLTAG
NT seq 396 nt   +upstreamnt  +downstreamnt
atggccgatgtccgcgtgatttgcgcgatcggacggcggggacagcttgggctcgacggg
cgcctgccttgggagggcaatcccggccgcgaatataaggccgacgtcgcgcgcttcttc
gatctgacgcgcggccatgtgctgatcgcgggaccccgcaccatcgcctcttttcccgac
tgggcgcggccggagcggacgctcgtggccgtgcgttcaagtgacgaacccgaagaggtg
attggccgttttccgggccgcgtcatattcatcggcggcggacctccggtgtggagcgcc
tatgcccgcttcgtcatgcattgggacgtgacgaagctcccctatgacggcgaagccgac
cgctatctcgatccggcctggctcaccgccgggtga

DBGET integrated database retrieval system