Microbulbifer spongiae: M8T91_00835 Help Entry M8T91_00835       CDS       T10475                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mspn  Microbulbifer spongiae Pathway mspn02024   Quorum sensing mspn03018   RNA degradation Brite KEGG Orthology (KO) [BR:mspn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     M8T91_00835 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     M8T91_00835 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mspn03019]     M8T91_00835 (hfq)    03036 Chromosome and associated proteins [BR:mspn03036]     M8T91_00835 (hfq) Messenger RNA biogenesis [BR:mspn03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      M8T91_00835 (hfq) Chromosome and associated proteins [BR:mspn03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     M8T91_00835 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WKD50002 UniProt:  A0ABY9ECW8 LinkDB All DBs Position 189567..189851 Genome browser AA seq 94 aa AA seqDB search MSKGHSLQDPYLNVLRKERIPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAIS TVVPSRAVRVPLLNPAAQHGGEGNAESGERESFS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcatagcttacaagacccttacctcaacgtattacgcaaagagcgtatc ccggtttctatctatttggtcaacggcatcaagctccaggggcaaattgaatctttcgat cagttcgtggtgttactaaaaaataccgtcagccaaatggtgtacaagcatgcaatttcc actgtggttccatctcgcgcggttcgcgtaccgctgctgaatccggcggctcaacatggc ggtgaaggtaatgcagaaagcggtgagcgcgaatccttcagctga

DBGET integrated database retrieval system