KEGG   Marinobacter salarius: AU15_14560
Entry
AU15_14560        CDS       T03593                                 

Name
(GenBank) methylmalonyl-CoA mutase
  KO
K20907  2-hydroxyisobutanoyl-CoA mutase small subunit [EC:5.4.99.64]
Organism
msr  Marinobacter salarius
Brite
KEGG Orthology (KO) [BR:msr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AU15_14560
Enzymes [BR:msr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     AU15_14560
SSDB
Motif
Pfam: B12-binding IMPDH IGPS Mut7-C
Other DBs
NCBI-ProteinID: AHI32048
UniProt: W5Z0N2
LinkDB
Position
2995353..2995748
AA seq 131 aa
MRVMLAKIGLDGHDRGIKVVARALRDAGMDVVYTGLHRTPEEVVDAAIQEDVDILGISLL
SGAHMHIFPKVLELLKDKEAEDMIVAGGGVIPDDDVKELYKMGVHKILLQDTPPQEIIDS
FRQMVADRGAR
NT seq 396 nt   +upstreamnt  +downstreamnt
attcgggtaatgttggcaaaaatcggtctggacggtcacgatcgcggcattaaagtggtc
gctcgtgcactgcgtgatgccggcatggatgtggtctataccggactgcatcgcacgcct
gaggaagtcgtggacgctgccattcaggaagacgtggacatcctcggcatcagcctgctg
tccggcgcgcacatgcacattttccccaaggtactggagctcctgaaagacaaggaagcc
gaagacatgatcgttgccggtggcggtgtcatccccgacgacgatgtcaaagaactctac
aagatgggcgtccacaagattcttcttcaggacactccgccacaagaaatcattgattcg
ttccggcagatggtcgcagatcgaggtgcccgttag

DBGET integrated database retrieval system