KEGG   Methylobacterium terrae: DK419_08915
Entry
DK419_08915       CDS       T06384                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
mtea  Methylobacterium terrae
Pathway
mtea00790  Folate biosynthesis
mtea01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mtea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DK419_08915
Enzymes [BR:mtea01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     DK419_08915
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: AWN46422
UniProt: A0A2U8WMI4
LinkDB
Position
1984251..1984655
AA seq 134 aa
MIDVRAMCAIGQRGQLGLHGRLPWEGNTDPLYVEDVTRFFAVTQGHVLIAGPKTIEAVPD
FAYQDRTIAVIRSHEDPRAVLARYPGRRIYVGGGIAVWNVYAPFIQQWDITRLPYDGEAD
RWFDPAWLVGRGRD
NT seq 405 nt   +upstreamnt  +downstreamnt
atgatcgacgtgcgggcgatgtgcgccatcgggcagcggggccagctcggcctccacggc
cggctgccctgggagggcaacaccgacccgctctacgtcgaggacgtcacccggttcttc
gccgtgacgcagggccacgtcctgatcgcgggcccgaagaccatcgaggcggtgccggac
ttcgcctaccaggaccggaccatcgcggtcatccgctcccacgaggacccgcgggcggtg
ctggcgcgctatcccggccggcggatctacgtcggcggcgggatcgcggtctggaacgtc
tacgcgccgttcatccagcaatgggacatcacccgcctgccctacgacggcgaggccgac
cgctggttcgatcccgcctggctggtggggcgggggcgggactga

DBGET integrated database retrieval system