Microbulbifer thermotolerans: A3224_16240 Help Entry A3224_16240       CDS       T04393                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mthd  Microbulbifer thermotolerans Pathway mthd00190   Oxidative phosphorylation mthd01100   Metabolic pathways Module mthd_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mthd00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A3224_16240  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mthd00194]     A3224_16240 Photosynthesis proteins [BR:mthd00194]  Photosystem and electron transport system   F-type ATPase [OT]    A3224_16240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AMX03932 UniProt:  A0A143HRN5 LinkDB All DBs Position complement(3911703..3911948) Genome browser AA seq 81 aa AA seqDB search MEALGLVYIASALLIGLGALGTAIGFGTLGGKLLEGSARQPEQAPALQGKMFLMAGLLDA VPMIGVGIAMYLIFAVAPGLA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaagcattaggtctggtttacatcgcaagcgcactgctgattggtctgggcgctctg ggcaccgccatcggtttcggcaccctgggtggcaagctgctggaaggctccgcgcgtcag ccggagcaggctcccgctctgcagggcaaaatgttcctgatggccggtctgctcgacgcc gttccgatgatcggtgttggtatcgccatgtatctgatttttgctgtagctcctggtctg gcgtaa

DBGET integrated database retrieval system