Neomoorella thermoacetica DSM 521: MOTHE_c10770 Help Entry MOTHE_c10770      CDS       T06431                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism mtho  Neomoorella thermoacetica DSM 521 Pathway mtho02024   Quorum sensing mtho03018   RNA degradation Brite KEGG Orthology (KO) [BR:mtho00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     MOTHE_c10770 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     MOTHE_c10770 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mtho03019]     MOTHE_c10770 (hfq)    03036 Chromosome and associated proteins [BR:mtho03036]     MOTHE_c10770 (hfq) Messenger RNA biogenesis [BR:mtho03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      MOTHE_c10770 (hfq) Chromosome and associated proteins [BR:mtho03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     MOTHE_c10770 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AKX93879 UniProt:  A0A1D7XA38 LinkDB All DBs Position 1039949..1040203 Genome browser AA seq 84 aa AA seqDB search MNKTQGNLQDLFLNVLRRDNTPVTIYLVNGFQLKGVVRGFDNFTVVLDADGKQQMIYKHA ISTIMPFRPVNLMAESRAQAEAKQ NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacccaaggaaacctgcaggatttgtttttaaacgtcttgcgtagggacaat acccccgtaaccatttacctggtcaatggctttcagttaaaaggtgtggtacggggcttc gacaattttaccgtcgtcctggacgccgacggcaaacagcagatgatttacaaacatgcc atatcaaccatcatgccctttcggccggtcaacctcatggctgaaagccgggcccaggcc gaggccaagcagtaa

DBGET integrated database retrieval system