Neomoorella thermoacetica DSM 2955: MOTHA_c20400 Help Entry MOTHA_c20400      CDS       T06429                                  Symbol porD2 Name (GenBank) pyruvate synthase subunit PorD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mthz  Neomoorella thermoacetica DSM 2955 Pathway mthz00010   Glycolysis / Gluconeogenesis mthz00020   Citrate cycle (TCA cycle) mthz00620   Pyruvate metabolism mthz00633   Nitrotoluene degradation mthz00640   Propanoate metabolism mthz00650   Butanoate metabolism mthz00680   Methane metabolism mthz00720   Other carbon fixation pathways mthz01100   Metabolic pathways mthz01110   Biosynthesis of secondary metabolites mthz01120   Microbial metabolism in diverse environments mthz01200   Carbon metabolism mthz01210   2-Oxocarboxylic acid metabolism Module mthz_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:mthz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MOTHA_c20400 (porD2)    00020 Citrate cycle (TCA cycle)     MOTHA_c20400 (porD2)    00620 Pyruvate metabolism     MOTHA_c20400 (porD2)    00640 Propanoate metabolism     MOTHA_c20400 (porD2)    00650 Butanoate metabolism     MOTHA_c20400 (porD2)   09102 Energy metabolism    00720 Other carbon fixation pathways     MOTHA_c20400 (porD2)    00680 Methane metabolism     MOTHA_c20400 (porD2)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MOTHA_c20400 (porD2) Enzymes [BR:mthz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase (ferredoxin)      MOTHA_c20400 (porD2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_7 Fer4_21 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_17 Fer4_8 LdpA_Fe-S-bd Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  AKX97376 UniProt:  A0A1D7XDA5 LinkDB All DBs Position complement(1989516..1989806) Genome browser AA seq 96 aa AA seqDB search MLREEELKKGPNLYTPFLGTTTGSWRLLRPVLDRERCNNCLACWLFCPEGCFRRGEEAVT LNLDFCKGCGICVTECPRQALALVEEGSNDARLLER NT seq 291 nt NT seq  +upstreamnt  +downstreamnt gtgttgagggaagaggaattaaagaagggtcccaacctttatacaccatttttaggtaca accactggatcctggcgcttgctgcgcccggtcctggaccgggagcgttgtaataattgc ctggcatgctggctcttctgtccggaggggtgttttcgccggggagaggaggcagttact ttaaatctggatttttgcaagggctgtggcatctgtgtgacggagtgtccccgccaggcc ctggcccttgtggaagaaggtagtaacgatgcgcgtctacttgaacggtaa

DBGET integrated database retrieval system