Mesitornis unicolor (brown roatelo): 104539281 Help Entry 104539281         CDS       T08455                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04060   Cytokine-cytokine receptor interaction mui04620   Toll-like receptor signaling pathway mui04621   NOD-like receptor signaling pathway mui04623   Cytosolic DNA-sensing pathway mui05164   Influenza A mui05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104539281 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104539281 (CCL5)    04621 NOD-like receptor signaling pathway     104539281 (CCL5)    04623 Cytosolic DNA-sensing pathway     104539281 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104539281 (CCL5)    05168 Herpes simplex virus 1 infection     104539281 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mui04052]     104539281 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:mui00536]     104539281 (CCL5) Cytokines and neuropeptides [BR:mui04052]  Cytokines   Chemokines    104539281 (CCL5) Glycosaminoglycan binding proteins [BR:mui00536]  Heparan sulfate / Heparin   Chemokines    104539281 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Hydrolase_4 CXCL16 Motif Other DBs NCBI-GeneID:  104539281 NCBI-ProteinID:  XP_010181062 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MMKVFAVCLSIILTATLFSQASPAPIGADTTVCCFSYTSRKLPQNHVKDYYYTSSKCSQP AVVFITRKDREVCANPDARWVKEYVNTLELQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgatgaaggtcttcgcagtgtgcctctccatcattctcactgccaccctcttttctcag gcctctcctgctccaattggggctgacacaactgtgtgctgcttcagctacacctcccga aagctgccccagaatcatgtgaaggattattactacaccagcagcaagtgctcacagcca gcagttgtgttcatcaccaggaaggaccgggaggtctgtgctaaccctgacgccaggtgg gtgaaggaatacgtgaacaccctggagctgcagtga

DBGET integrated database retrieval system