KEGG   Meriones unguiculatus (Mongolian gerbil): 110555753
Entry
110555753         CDS       T05884                                 
Symbol
Tnfrsf8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110555753 (Tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110555753 (Tnfrsf8)
   04090 CD molecules [BR:mun04090]
    110555753 (Tnfrsf8)
Cytokine receptors [BR:mun04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110555753 (Tnfrsf8)
CD molecules [BR:mun04090]
 Proteins
  110555753 (Tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 110555753
NCBI-ProteinID: XP_021504833
LinkDB
Position
Unknown
AA seq 551 aa
MQQGLPALQWECHPWAGGCIKKVAGCEPESELVISAPPPSGLQFLSWLFHVEAAWTHPSP
GCFWSRCLSKQQKDRPLKTTCAGGPNYYPGETAGSCCHQCPSGMSPTQPCPQGPAHCRKQ
CAPEYYLNEDGYCTACVTCLQGLVEKAPCSGNSSRVCECQPGTFCSTTAVNSCARCSPHS
RCSGGEIVKFPGTAESDTVCELPSAGPGPNCSNADDCKTLTSPGTPQATPTLKSPATDSV
RSLLPRGSTRPVQEGDAGLLKILESPVPQAREPSAEPGNPEMNMTLELPPPETLPDFSTS
ENSEEPASTASTLSLLVDAQTSNRMQPTSPSSTGRPFLDPGRMFFWVAMVVLLAGSGTFF
LCYWKVFRKRIQQKFPLDYLAQTFQPKVEQADSRPPEKLTQLKRNGSVTDPSSVHKPSPV
SPPAVDTCASVGAACPESLPLLDDGTAGNPLSPREPPEPRASTEHTNNRIEKIYIMKADT
VIVGSVKTEVPEGRAPAGSTEPKMGAELEVDHAPHYPEQETEPPLGSCTEVMFSVEEGGK
EDHGPITVSEK
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgcagcagggcctgccagccctgcagtgggagtgccatccctgggcgggtggctgtata
aagaaggtagccggctgtgagcctgaaagcgagctagtgatcagcgctcctccgccatca
gggctgcagttcctgtcctggcttttccacgtagaagccgcgtggactcatccctcgcca
ggttgcttttggtcgcgatgtttatcaaagcagcagaaggaccgacccctgaagaccacc
tgtgcaggaggccccaactactaccctggggagactgccgggagctgctgtcaccagtgc
ccctccgggatgtctccaacccagccatgcccgcagggtcctgcgcactgcaggaagcaa
tgtgctcccgagtactacctgaatgaggacgggtactgcacagcctgtgtgacctgtttg
caaggccttgtggagaaggctccatgttccggaaactcttctcgcgtctgtgagtgtcag
cccggcaccttctgctccacgacggctgtcaattcctgtgcccgctgttccccacactcc
cgatgttctgggggggagatcgtcaagttcccaggcacggcggagagtgacactgtctgt
gagctgccttccgcaggacctggccccaattgctccaatgcagacgactgcaagacactt
acgagccctggcactcctcaggccacacccactctaaagtccccagctacggacagtgtg
aggagcctgctgccaagagggagcacccgccctgtgcaggaaggtgatgctgggctcctg
aagattctggagtcgcccgttccccaggcgagggagcccagcgcagagccaggcaatcca
gagatgaacatgaccttggagctgccacctccagagaccctacctgacttcagtacctca
gaaaacagcgaggagcctgccagtaccgcctccaccctaagcctcctggtagatgcccag
accagcaacaggatgcagcccacctcaccctcgtccacaggaagaccatttctggatcca
gggcgtatgttcttttgggtggccatggtggtgctgctggccggctccggcaccttcttc
ctgtgttattggaaggtcttcaggaagcggatccagcagaagtttcccctggactaccta
gcccagaccttccagcccaaagtggagcaggcagattccagacctcctgaaaagctgaca
cagctgaagagaaacgggtcagtgacagaccccagctctgtacacaagccgagcccagtg
agccccccagctgtggatacttgtgccagtgttggggcagcctgcccggagagcctgccc
ctgctggatgacggcacagctgggaatcctttgagtcccagggaacctccagagccccgg
gcatccacagaacatacaaacaacaggattgagaaaatctacatcatgaaggctgacacg
gtgatcgtgggctctgtaaagaccgaagtccctgagggccgggctccggcagggtctaca
gagcctaagatgggagctgagctggaggtggaccatgccccccactacccggagcaggaa
acagaaccgcctctgggcagctgcactgaggtcatgttctcggtagaggaaggaggaaaa
gaggaccacgggcctataactgtctctgagaagtga

DBGET integrated database retrieval system