Musa acuminata (dessert banana): 135627611 Help Entry 135627611         CDS       T03447                                  Name (RefSeq) probable histone H2A.6   KO K11251   histone H2A Organism mus  Musa acuminata (dessert banana) Pathway mus03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:mus00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     135627611  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mus03036]     135627611   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mus04147]     135627611 Chromosome and associated proteins [BR:mus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     135627611 Exosome [BR:mus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135627611 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Motif Other DBs NCBI-GeneID:  135627611 NCBI-ProteinID:  XP_064989807 LinkDB All DBs Position BXJ2-11:complement(32221919..32222179) Genome browser AA seq 86 aa AA seqDB search MKKRVSRSVKDDIQFPDGRYAQRVGLASHVIDEWIHEASTSRLHWDLLADVSIAHGGMLP DINQVLLPKKTDEVSEEPKSGAQEGC NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaagaagcgtgtctcccggtccgtcaaggacgacatccagttcccggacggtcgctac gcccaacgcgtcggtctcgcgtctcatgtgatagatgagtggattcatgaagcttcgact tctcgtcttcactgggatcttctggcggacgtgagcattgcccacggcggaatgctcccc gacatcaaccaggtgttgctgccgaagaagacggacgaggtctccgaggaacccaagtcg ggcgcccaagaaggctgctaa

DBGET integrated database retrieval system