KEGG   Myotis brandtii (Brandt's bat): 102257734
Entry
102257734         CDS       T02920                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102257734 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:myb04050]
    102257734 (TNFRSF8)
   04090 CD molecules [BR:myb04090]
    102257734 (TNFRSF8)
Cytokine receptors [BR:myb04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102257734 (TNFRSF8)
CD molecules [BR:myb04090]
 Proteins
  102257734 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 102257734
NCBI-ProteinID: XP_014400942
LinkDB
Position
Un
AA seq 566 aa
MRVEGVPLRVCQGGLAWSFSASFPGSSPQHLCPQGPSGCRKQCQRDYYLDRANRCTACVT
CSGDLVEKKPCSGNSPRVCECRAGTFCATLASNSCARCFPHSVCPPGTIVKFPGTAQRDT
VCEPLSPGTSPGCGTSPEDCRAPASGTTPPAEPTLTSASSDARTPLLEGDTPLTPEADSK
MMRAPNSLSPVGKPRLDSGRSLQRLCPLGSADCRKQCERDYYLDRDGRCTACVSCSGDDL
VEKTPCTWNSSRVCECRPGMVCVTSATNSCARCIARPVTPPQVVTTPQGKAERDTTYEPP
HLGTHLNRSTNPEDGELPASTSASRISLAGKGHGGDASLSTSAPVSFSSARRPILVSGPV
LLWLLALLAAAVCAGSFLLCHRRACWKWMQQKLHLCYPVQTFRPKPEAADSNPPRNQTLK
SLLVREPRTETLGLMSPPAVEPCTHVGAAGLESLPLVGASPAGSPSSPRDLPEPRVTTEH
TNNRIEKIYIMKADTVIVGTVKTEAPEGRGLAGPAGPELEEDLEMDHAPHYPEQETEPPL
GSCRDVMFSVEEEGKEDPLPETASGK
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgagagtagaaggggtgcccctgagagtttgccaaggtggcctggcctggagcttctcc
gcttcttttccagggtcctccccacagcatctgtgcccgcaggggccatctggctgcagg
aagcagtgccagcgggactactacctggacagggccaaccggtgcacagcctgcgtgacc
tgcagcggcgaccttgtggagaagaagccatgttcggggaactccccccgcgtctgtgaa
tgccgggccggcacgttctgtgccacattagcctccaactcctgtgcccgctgcttcccc
cactccgtctgccccccagggacgattgtcaagttccccggtacagcgcagagggacacc
gtctgtgagcccctttccccggggaccagccctggctgcggcaccagcccggaggactgc
agggcgcctgccagcggcaccacccctccggccgagcccaccctgacctcagccagctcc
gatgccaggaccccgcttcttgaaggggatactcctctcacccccgaagccgattccaaa
atgatgagggctcccaactctctctcccccgtggggaagcccaggctggattcagggcgg
tccctgcagcgcctgtgccctctggggtccgccgactgcaggaagcagtgtgagcgggac
tactacctggacagggacggccgctgcacagcctgtgtgagctgctcaggagatgacctc
gtggagaagacaccttgcacgtggaactcctcccgcgtctgtgaatgtcgccctggcatg
gtctgtgtcacgtcagccaccaactcctgcgcccgctgcatcgcccgccctgtcacccca
ccccaagtggtcaccacaccccagggcaaagctgagagggacaccacctacgagccgcct
cacctggggacccaccttaaccgcagcaccaacccagaggacggcgagctgccggccagc
accagcgcctcccggatctccctggccgggaaggggcatggaggagacgcctccctctca
acaagtgctcccgtctctttctcctccgcgaggagacccatcctggtttcaggccccgtg
ctcctctggctgctggcgctgctggcggcggccgtctgcgccggctccttcctcctgtgc
caccgcagggcctgctggaagtggatgcagcagaagctccacctgtgctacccggtccag
accttccggcccaagcccgaggctgcggattccaaccccccgaggaaccagacactgaag
agcctcctggtgagagagccccgcaccgaaacgctggggttaatgagccccccggctgtg
gagccctgcacccacgtgggggcagccggcctggagagcctgccgctggtgggggccagt
ccagccgggagcccctcatcccccagggaccttcccgagccccgggtgaccacggaacat
accaacaacaggatcgagaaaatctacatcatgaaggccgacacagtgatcgtggggacc
gtgaagaccgaggcgccggagggccggggcctggcggggccggccgggcctgagctcgag
gaggacctggagatggaccatgccccacactacccggagcaggagacggaaccacctctg
ggcagctgcagggacgtcatgttctcggtggaggaggaagggaaggaggaccccttgcct
gagacggcgtctgggaagtga

DBGET integrated database retrieval system