Myotis brandtii (Brandt's bat): 102263566 Help Entry 102263566         CDS       T02920                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04080   Neuroactive ligand-receptor interaction myb04911   Insulin secretion myb04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102263566 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102263566 (CCK)   09154 Digestive system    04972 Pancreatic secretion     102263566 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myb04052]     102263566 (CCK) Cytokines and neuropeptides [BR:myb04052]  Neuropeptides   Neuropeptides (GPCR binding)    102263566 (CCK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102263566 NCBI-ProteinID:  XP_005860497 LinkDB All DBs Position Un AA seq 76 aa AA seqDB search RQLRAVQRVDGEPPAHLGALLARYIQHARKAPSGRISMIKNLQSRDPSHRISDRDYMGWM DFGRRSAEVEEYEYPS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt agacagctgagggcggtgcagagggtggacggcgagcccccagcgcacctgggcgcgctg ctggccagatacatccaacatgcccggaaagctccctctggccgcatatccatgatcaag aacctgcagagccgggaccccagccaccggatcagcgaccgggactacatgggctggatg gacttcggccggcgcagcgccgaggtggaggagtacgagtacccctcctag

DBGET integrated database retrieval system