KEGG   Myotis davidii (David's myotis): 102753619
Entry
102753619         CDS       T02992                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
myd  Myotis davidii (David's myotis)
Pathway
myd04927  Cortisol synthesis and secretion
myd04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:myd00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102753619 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102753619 (MRAP)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 102753619
NCBI-ProteinID: XP_006753189
LinkDB
Position
Un
AA seq 124 aa
MATANNSNASAPSFGYEYYLDYLDLLPVDEKQLRAHKYSVVIAFWASLAAFVVLLFLVLL
SMSRRAPGARSSAPRHPACPCGLHITSAITAAHALTPSPRLGRSDEPSAGSPVVRGAGCG
HAEL
NT seq 375 nt   +upstreamnt  +downstreamnt
atggccacggccaacaacagcaacgcctccgcgccctccttcggctacgagtactacctg
gactacctggacctgctccccgtggacgagaagcagctgagagcccacaagtactcggtg
gtgatcgccttctgggcaagcttggctgccttcgtggtgctcctcttcctcgtcctgctc
tccatgtcccgccgggctcccggggccaggagcagtgccccgcgccaccctgcgtgcccc
tgcggcctccacatcacctccgccatcactgctgcacacgcattgaccccgagtccccgg
ctgggccgtagtgacgagccgagcgccgggagccctgtggtgcggggtgcggggtgcggg
cacgcagagctctga

DBGET integrated database retrieval system