KEGG   Myotis davidii (David's myotis): 102753840
Entry
102753840         CDS       T02992                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
myd  Myotis davidii (David's myotis)
Pathway
myd04610  Complement and coagulation cascades
myd04810  Regulation of actin cytoskeleton
myd05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102753840 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102753840 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102753840 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:myd04515]
    102753840 (ITGAX)
   04090 CD molecules [BR:myd04090]
    102753840 (ITGAX)
Cell adhesion molecules [BR:myd04515]
 Integrins
  Integrin alpha subunits
   102753840 (ITGAX)
CD molecules [BR:myd04090]
 Proteins
  102753840 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 VWA_2 FG-GAP FG-GAP_2 Integrin_alpha VWA_CoxE FG-GAP_3
Other DBs
NCBI-GeneID: 102753840
NCBI-ProteinID: XP_015415161
LinkDB
Position
Un
AA seq 1068 aa
MSRTRTALLLLMGVASSLCFNLDTDKPTIFPMHSAGFGHSVVQYANWVVVGAPLEIKAVN
QTGGLYRCDYSTATCEPIQLQTPPEAVNMSLGLSLTAATTPPRLLACGPTVHHACNENMH
LAGVCFLWASSSWPTRRLPDALQECPRQEQDIVFLIDGSGSISSRDFAKMLSFVKAVMSQ
FQRPRAQFSLMQFSSTFRVHFTFKEFSQSSNPLRLLDSVRQLNQYTHTASAILRVTEELF
SAHKGARQDASKILIVITDGDKTGDNLEYEDVIPRAEAKGIVRYAVGVGSAFQDLRAFAE
LNAIASRPPQEHIFRVDNFDALRDIQRQLKEKIFAIEGTHTVSSSSFELEMSQEGFSAVL
TPDGPVLGAVGSYSWSGGAFLYPQNKKPPTFINMSQENLDMMDSYLGERRLWLARWQCRA
ILRGEQGHPWGRFGAALTAMGDVNGDKLTDVAIGAPGEDENQGAVYLFHGASGPGLSPSH
SQRIRGSQLSPGLQHFGQSLSGGQDLTLDGLVDLAVGAQGHALLLRTRPVLRVWVDIRIT
PAEIARSVFECRENTASIRDLGDATVCLRVHESPRTRLGNLQSDVTFDLTLDPGHLSPRA
IFKETNTRHLSRVRVLGLRQHCEDVKLLLPACVEDAMIPITLSLNFSLVGQPIPSFGNLQ
PILAPDTRRHFTTSLPFEKNCGDDHVCQDDLGITVDASGLETLVVGNTLELNMGVKVWNE
GEDSYGTTVTFSYPPGLSYRRATVTQSRPPSRSLQLACDSGSQDAWSTRCSLKHIIFREG
AQVTFVATFDVSPKAILGDRLLLMANVSSENNSPRTSRTTSRLELPVKYSVYIVVSSHEE
STKYLNFSAPEEEGSSVAQLRYQVSNPGQRDLPVSIYFLVPVELNQAAVWTELELLHPQS
PSMNCSSERIAPTEADPRAHIQKNPALDCSAAACQRFRCDVPSFGTQEELDFTLKGNLSF
GWVRQTLQKKVSVVSVAGITFDRSVYAQLPGQEASLRAQMEMVLEEYEVYDPVPLIVGSC
VGGLLLLALITAMLFKLGFFKRRYKEMMDDKPEDAAMFSGEAPNLPLS
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgagcaggaccaggacagcccttctcctgttgatgggcgtggcttcctctctctgcttc
aacttggacacggacaagccgaccatcttccccatgcacagcgccgggtttggacacagt
gtggtccagtatgccaactgggtggtggtgggagcccccctggagataaaggctgtcaac
caaaccggtggtctctaccggtgtgactacagcacggccacctgtgagcccatccagctg
cagacgcccccagaggctgtgaacatgtccctgggcctgtccctgacagctgccaccaca
ccccctcggctgctggcctgcggccccactgtgcaccacgcatgcaacgagaacatgcac
ttggccggggtctgcttcctgtgggcctcctcctcctggccgacccggaggctcccagat
gccctgcaggagtgcccgaggcaggagcaggacatcgtgttcctgatcgacggctcaggc
agcatcagctccagggattttgccaagatgctgagcttcgtgaaggctgtgatgagccag
ttccagagacccagggcccagttctccctgatgcagttctccagcaccttccgggttcac
ttcacgttcaaggaattctcgcagagctcaaacccactgcggctgctggactctgtgaga
cagctgaaccagtacacgcacacggcctcagctatcctgagggtcacagaagagctgttc
agtgcccacaagggggccagacaggacgcctccaagatcctcatcgtcatcacggatggg
gataaaacaggcgacaacctggaatatgaggatgtcatcccccgggccgaggccaagggc
atcgtccgctatgcggtcggggtggggtcggcttttcaggacctacgcgccttcgcagag
ctgaacgccatcgcgtccaggccgccgcaggagcacatattcagagtggacaactttgat
gccctgagagacattcaaaggcagctgaaagagaagatctttgccattgagggtacgcac
accgtgagcagcagctccttcgagttggagatgtcccaggagggcttcagcgcggtgctc
acgcccgacggaccagttctgggcgcagtggggagctacagctggtctggaggtgccttc
ctgtacccccaaaacaagaaacctcccaccttcatcaacatgtctcaggagaacctggac
atgatggactcctacctgggtgagaggaggctctggctggccaggtggcagtgccgggcc
attctccgtggggagcagggccacccctggggccgctttggggcagccctgaccgccatg
ggggacgtgaatggggacaagctgacggacgtggccatcggggcccctggggaagacgag
aaccagggtgccgtgtacctgttccacggagcctcggggccgggcctcagcccctcccac
agccagaggatcagaggctcccagctctcccccgggctccagcactttggacagtcgctg
agcgggggccaggacctcaccctggatggccttgtggacctggctgtgggggcccaggga
cacgcactgctgctcaggaccagacctgtgctcagggtgtgggtggatatccgcataaca
cctgcagagattgctaggtctgtgttcgagtgtcgggagaacacagcctccatccgggac
ctgggtgatgccacagtctgccttcgtgtccatgaaagtcccaggacccggctgggtaac
ctccaaagtgatgtgacctttgacctgacccttgaccctggccacctgagtccccgagcc
atcttcaaggagacgaacactcggcatctgagccgcgtcagagtcctcggtctgagacag
cactgcgaggacgtgaagctgctgctccctgcttgtgtggaggacgcgatgatccccatc
accttgagtctcaatttctccctggtgggccagcccatcccttcctttgggaacctccag
cctattctggctccggacacccgcagacacttcacgacctctctcccctttgagaagaac
tgtggggatgaccatgtctgccaggatgaccttggcatcaccgttgacgcctctggcttg
gagaccctggtggtggggaacaccctggagctgaacatgggagtgaaagtgtggaatgag
ggcgaggactcctatgggaccacggtcaccttctcctacccgccaggcctgtcctaccgg
cgggcgacagtgacccagagccggccgccatcacgctccctgcagctggcctgcgacagc
gggagccaggacgcctggagcacccgctgcagcctcaagcacatcatcttccgcgagggc
gctcaggtcaccttcgtggccacctttgacgtctcccccaaggccattctgggagaccgg
ctgcttctaatggccaatgtgagcagcgagaacaactcccccaggaccagcaggaccacc
tcccggctggagctgcccgtgaagtactccgtctacatcgtggtcagcagccacgaagaa
tccaccaagtacctcaacttctcggccccagaggaggaggggagcagcgtggcccagctc
agataccaggtgagcaacccgggacagagggacctgcctgtcagcatctacttcttggtg
cctgtggagctgaaccaggcggcggtgtggacagagctggagctcctccacccccagagc
ccatctatgaactgctcttcagagagaatagcgcccacagaggccgacccccgggcccac
attcagaagaatcccgcgctggactgctccgctgccgcctgccagaggttccgctgtgac
gtcccctccttcggcacccaggaggaactggacttcaccctgaagggcaacctcagcttc
ggctgggtcagacagactctgcagaagaaggtatcggtggtgagtgtggcgggaatcacg
ttcgacagatccgtgtatgcccagctcccgggccaggaggcgtctctgagagcccagatg
gagatggtgctggaagagtatgaggtgtatgaccccgtgcccctcatcgtgggcagctgt
gtgggaggactgctgctgctggctctcatcacagccatgctcttcaagcttggcttcttc
aaacgtcggtataaagaaatgatggatgacaagcccgaagacgctgccatgttcagcggg
gaggcccccaatttgcctttgtcctaa

DBGET integrated database retrieval system