Mycobacterium sp. MS1601: BVC93_21355 Help Entry BVC93_21355       CDS       T10274                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism myw  Mycobacterium sp. MS1601 Pathway myw00261   Monobactam biosynthesis myw01100   Metabolic pathways myw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:myw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BVC93_21355  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:myw01008]     BVC93_21355 Polyketide biosynthesis proteins [BR:myw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BVC93_21355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQA04551 LinkDB All DBs Position 4411984..4412196 Genome browser AA seq 70 aa AA seqDB search MSSNPFDDEDGTFYVLVNDEEQHSLWPTFADVPAGWTVAFGAANRSDCLAYVEENWTDMR PLSLRRSLQS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaatcccttcgatgacgaggacggcaccttctatgtgctggtcaacgacgag gaacagcacagtctgtggccgacgtttgccgacgtgccggccggttggacggtggccttc ggcgcggccaaccgtagcgactgcctggcctatgtcgaggagaactggactgatatgcgt ccgctgagcctgcggcggtcgttgcagagctag

DBGET integrated database retrieval system