Maylandia zebra (zebra mbuna): 101474892 Help Entry 101474892         CDS       T02814                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04010   MAPK signaling pathway mze04012   ErbB signaling pathway mze04068   FoxO signaling pathway mze04137   Mitophagy - animal mze04140   Autophagy - animal mze04144   Endocytosis mze04150   mTOR signaling pathway mze04210   Apoptosis mze04218   Cellular senescence mze04370   VEGF signaling pathway mze04371   Apelin signaling pathway mze04510   Focal adhesion mze04540   Gap junction mze04625   C-type lectin receptor signaling pathway mze04810   Regulation of actin cytoskeleton mze04910   Insulin signaling pathway mze04912   GnRH signaling pathway mze04916   Melanogenesis mze05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mze00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101474892 (hras)    04012 ErbB signaling pathway     101474892 (hras)    04370 VEGF signaling pathway     101474892 (hras)    04371 Apelin signaling pathway     101474892 (hras)    04068 FoxO signaling pathway     101474892 (hras)    04150 mTOR signaling pathway     101474892 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101474892 (hras)    04140 Autophagy - animal     101474892 (hras)    04137 Mitophagy - animal     101474892 (hras)   09143 Cell growth and death    04210 Apoptosis     101474892 (hras)    04218 Cellular senescence     101474892 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101474892 (hras)    04540 Gap junction     101474892 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101474892 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101474892 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     101474892 (hras)    04912 GnRH signaling pathway     101474892 (hras)    04916 Melanogenesis     101474892 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101474892 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mze04131]     101474892 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mze04147]     101474892 (hras)    04031 GTP-binding proteins [BR:mze04031]     101474892 (hras) Membrane trafficking [BR:mze04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101474892 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     101474892 (hras) Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101474892 (hras)   Exosomal proteins of colorectal cancer cells    101474892 (hras) GTP-binding proteins [BR:mze04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101474892 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  101474892 NCBI-ProteinID:  XP_004563448 UniProt:  A0A3P9CMD3 LinkDB All DBs Position LG7:complement(5904402..5922319) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAHELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcacttacc atacagctgatccagaaccactttgtggatgaatatgaccccacaatagaggactcatac aggaagcaggttgtgatcgacggggagacctgcctgttggacatcctggacactgcaggt caagaggagtacagcgccatgagggatcagtacatgaggacgggggagggcttcctgtgt gtcttcgccatcaacaataccaagtcttttgaggacattcaccagtatagagaacagatt aagcgtgttaaggattccgatgatgttcccatggtccttgtgggaaacaaatgtgacctc cctgcgcgcacggtggacacgaggcaagcccatgagctcgctcgctcctatggcatcccc tacattgagacctctgccaaaacacggcagggagtagaggacgccttctacacactggtt agagagatcaggcagcataagttgaggaagttgaacccacccgatgagagtggtcaagac tgtatgagctgtcgctgtgtggtgtcgtga

DBGET integrated database retrieval system