Nocardioides aquaticus: ENKNEFLB_01240 Help Entry ENKNEFLB_01240    CDS       T07580                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism naqu  Nocardioides aquaticus Pathway naqu00074   Mycolic acid biosynthesis naqu00280   Valine, leucine and isoleucine degradation naqu00630   Glyoxylate and dicarboxylate metabolism naqu00640   Propanoate metabolism naqu01100   Metabolic pathways naqu01110   Biosynthesis of secondary metabolites naqu01120   Microbial metabolism in diverse environments naqu01200   Carbon metabolism Module naqu_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:naqu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     ENKNEFLB_01240    00640 Propanoate metabolism     ENKNEFLB_01240   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     ENKNEFLB_01240   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     ENKNEFLB_01240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  QVT78862 UniProt:  A0ABX8EFJ6 LinkDB All DBs Position complement(1273772..1273996) Genome browser AA seq 74 aa AA seqDB search MAAEDETPAPPALRVVKGDPTPEELAALVAVIAAMGGAEAPAPRRTSAWSAPRRRHREPL HHGVGGWRASGLPR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccgccgaggacgagaccccggccccgccggcgctgcgtgtcgtgaagggcgacccg acacccgaggagctcgcggcgctggtcgccgtgatcgcggcgatgggcggcgccgaggca ccggccccccgccgtacgtccgcgtggtcggcgccgcggcgacgtcaccgcgagccgctg caccacggcgtcggtggctggcgggccagcggcctgcctcgctag

DBGET integrated database retrieval system