KEGG   Natrinema sp. J7-2: NJ7G_1323
Entry
NJ7G_1323         CDS       T02184                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00053  Ascorbate and aldarate metabolism
nat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    NJ7G_1323
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     NJ7G_1323
SSDB
Motif
Pfam: Epimerase NAD_binding_4 NAD_binding_10 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind DapB_N GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: AFO56570
UniProt: I7BUL5
LinkDB
Position
1180381..1181154
AA seq 257 aa
MTAIAITGAAGKVGRQAIDAFPDDHDLTLVSHHETADLETELLEITEREAFVDALKGQDV
LLHLSANPSPRAEWDEVRGPNVDGVYNAFEAAIEHDLQRVVFASSNHAVNMRNAVSGIRP
ESTVGRPAIVRPDDPADPDTYYGVTKAFGEAMGSYYAKRHGLEVVNLRIGWLLTRDDLRR
ECRERDGAGERYARAMWLSPDDCRRLLNAAVTATLSGSPLTAHGISANSERFLSLSETMR
DLGYRPQDDAEAVLNDG
NT seq 774 nt   +upstreamnt  +downstreamnt
atgactgccatcgcgatcaccggcgcggcgggcaaggtcggccggcaagccatcgacgcg
tttcccgacgaccacgacctcacgctcgtttcccaccacgagactgcggacctcgagacg
gaacttctcgagatcaccgagcgcgaggcgttcgtggacgccctcaagggccaggacgtg
ttgctccacctctcggcgaacccgtcgccgcgagccgagtgggacgaggtgcgagggccg
aacgttgacggcgtctacaacgcgttcgaggcggcgatcgagcacgacctccagcgggta
gtcttcgcgagttcgaaccacgcggtcaacatgcgaaacgccgtctcggggatccgaccg
gagtcgacggtgggccgtccggccatcgtccgacccgacgatccggcggatcccgacacg
tactacggcgtcactaaggccttcggcgaggccatgggatcgtactacgcgaagcgccac
ggcctcgaggtggtgaacctgcggatcggctggctgctcacacgggacgacctccggcgg
gagtgtcgcgaacgggacggcgcgggcgagcgctacgcccgcgcgatgtggttgagtccc
gacgactgccgacggctgctcaacgcggccgtgacggcgacccttagcgggtcgcccctg
accgcacacggtatctccgccaactccgaacggttcctctcgctgtccgagacgatgcgc
gacctcggctaccggccacaagacgacgccgaggcggttctgaacgacggatga

DBGET integrated database retrieval system