Aquisalimonas sp. 2447: HC341_12705 Help Entry HC341_12705       CDS       T06517                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism nax  Aquisalimonas sp. 2447 Brite KEGG Orthology (KO) [BR:nax00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nax03032]     HC341_12705    03036 Chromosome and associated proteins [BR:nax03036]     HC341_12705    03400 DNA repair and recombination proteins [BR:nax03400]     HC341_12705 DNA replication proteins [BR:nax03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HC341_12705 Chromosome and associated proteins [BR:nax03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HC341_12705 DNA repair and recombination proteins [BR:nax03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HC341_12705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 SeleniumBinding Motif Other DBs NCBI-ProteinID:  QIT55988 UniProt:  A0A6H0IXH4 LinkDB All DBs Position complement(2693598..2693870) Genome browser AA seq 90 aa AA seqDB search MNKSELIEAVAQNADLSKASAARAVDAMVDAVTNALKENDSVSLVGFGTFSVRERAARSG RNPRTGATINIPATKVPSFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataagtcggaacttattgaagcggtcgcccagaacgccgatctatccaaggcctcc gcggcgcgtgccgttgacgccatggttgatgcagtgaccaacgccctcaaggaaaacgac tccgtgagcctggtcggcttcggaaccttctccgtgcgcgagcgtgctgcacgctccggg cgcaacccgcggaccggcgccaccatcaacattccggccaccaaggtgccgagcttcaag gctggcaaagccctgaaggatgctgtaaactag

DBGET integrated database retrieval system