KEGG   Naumovozyma castellii: NCAS_0A08270
Entry
NCAS_0A08270      CDS       T02233                                 
Symbol
NCAS0A08270
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
ncs  Naumovozyma castellii
Pathway
ncs04111  Cell cycle - yeast
ncs04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NCAS_0A08270 (NCAS0A08270)
   04113 Meiosis - yeast
    NCAS_0A08270 (NCAS0A08270)
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 11526636
NCBI-ProteinID: XP_003673766
UniProt: G0V7D7
LinkDB
Position
1:1633374..1635182
AA seq 602 aa
MNSYSINKSRIPIIDLNQISDEKQLLPVIKSILLVTDTFLLKNYANKDVLDSLMEQLEFP
QNAPDVNQGFDANFTGSLRLDNDIWMEQYILNTDPSLQFNRKCKNVTLQKIYSRLFKINM
FFSQLCLKSIVSDQLLQSSLTDDTYATKLTRYYHEQKRSNEDENENGLFIADGENFEYLF
NREFHTHSSSGILTVFPIAQGIKYKPPTTSSDDNVWTTIDEPDCLLFHTGTLLANWSQGL
HSTSPLQLDLNANLVHLTVWPPLNSPLNDSRTIADELLRQQIQEFPEVGTKFYNNETQRI
QLEQNINFIRKLFIVAESVISLNAISKSSGVASELQSLLPQMSNMMTKKISQDDFLKILT
IWPECYIVEANSLLELTVQLPERNSLMVLTNKSRRLEFVERCETWLREKCSGASIPNDIP
PYRIIKRRSSLDDNEGGSSVDEKRMEGRKLSSHPSKTKNYIHNYKEQFLSREKKNDSQSN
LLERLRERERKSAALLSQRQRNYQQFLAIKMTQVFDILVSLQWGQPYTVTHLSSLIVDSL
QDSNNPIGDNEAEEILDKLQYLLSDIISVHIVDGGLKVYRWDQLDKNKFQTSIQEYRNDR
ES
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgaattcctactcaattaataaatctagaatccctatcattgatttgaatcagatatct
gatgagaagcaattactgccggtaataaaatcgatattgttggttactgacacatttctt
ttaaagaattacgcaaataaagatgtcttagactctctaatggaacaattagaatttcca
caaaacgcaccagacgtcaatcaggggtttgatgccaattttacaggctctttacgtcta
gataatgatatttggatggaacagtatattttaaatacagatccaagtttacaattcaac
agaaaatgtaaaaacgttactttacagaaaatatattccagattatttaaaataaacatg
tttttttctcaattatgtttaaaaagcatagtttccgatcaattattacagtcatctctt
actgacgatacgtatgcgacaaaattgacaagatactaccatgagcaaaaacgttctaat
gaagatgaaaatgaaaatggtttgttcattgcagatggtgagaatttcgaatatttattt
aatcgtgaattccatacccactcatcatctggaattcttacagttttccccatagctcaa
ggtataaaatataaaccacctacgacaagttcagatgataacgtatggacaactatcgat
gaacctgactgtcttctcttccatacagggacattactggcgaactggtctcagggatta
cattccacatctcctttgcaactagatctcaatgcaaatcttgtccatctgactgtatgg
cccccgttaaattcacctttgaatgattctcgaacaatagcagatgaattgttaagacaa
caaattcaagagtttccagaggtaggaactaaattctataataatgaaactcaaaggatt
caattggaacaaaacattaattttattagaaaactattcattgtagcagaaagtgtcatt
tctctgaacgcgatatctaaatcaagtggtgttgcatcagaattgcaatctttattaccg
caaatgtcgaatatgatgacgaagaagatatcgcaggatgattttttaaagatattaaca
atttggcctgaatgttatatagtagaggcaaatagtttattggaattaaccgtccaatta
ccagagagaaattcattgatggtgttgacaaataaatctagacgactagaattcgttgag
agatgtgaaacatggttaagagaaaaatgttctggtgcctcaatacccaatgatatccca
ccttataggataataaaaagacgtagtagtttagatgacaatgaagggggatcttctgtg
gatgaaaaacgtatggaaggacggaaattgagtagccacccttccaagacaaagaattac
atacacaattataaggaacaatttctctctcgagaaaagaagaatgattcacaatcaaat
ctattagaaagattgagagaaagggaaagaaaatcggctgcccttttatcccaaagacaa
cgaaattatcagcaattcttggctataaaaatgacacaagtctttgatatcttggtatcc
cttcagtggggccaaccatatacagttactcatctaagttcattgatcgtagatagttta
caagacagtaacaatccaattggtgataatgaggcggaggagatcttagataagttacaa
tacctcttgagtgatattatttcagttcatatcgttgatggcggcttaaaagtttatcga
tgggatcaattagataagaacaaatttcaaacctcaattcaagaatatagaaatgatagg
gagtcttga

DBGET integrated database retrieval system