KEGG   Naumovozyma dairenensis: NDAI_0C05880
Entry
NDAI_0C05880      CDS       T02234                                 
Symbol
NDAI0C05880
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04111  Cell cycle - yeast
ndi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0C05880 (NDAI0C05880)
   04113 Meiosis - yeast
    NDAI_0C05880 (NDAI0C05880)
SSDB
Motif
Pfam: Fungal_TACC SHE3 Docking
Other DBs
NCBI-GeneID: 11496419
NCBI-ProteinID: XP_003669490
UniProt: G0W8Y6
LinkDB
Position
3:1346220..1348760
AA seq 846 aa
MEFNMNDGEQLPTTPIRQVSDISQIAHGEKRSLEDNQLDGNSSELIVHLHGLPSRRKSIR
LPELEEANAVSPSINKDNRSHENGNNSIVDVSEDMSLDFNRGTNDDKTSPTKSTLENLDI
NKLFASSNNASNNHNDNDQNTNGDKISESKLLNHSPIKLELSSPMKQMDQAENADENETA
NDNSHVRKKLKLDRESVPNLTQQLNNNEMEMGGTSPSPIEMIDMQISPIKSSLSPIQRTP
PHRSNDEPQRDDENNNAADNNNTTNNHISSAHQLTPLYDIDNHREDGGTKEQGLGNDDVE
DENEDEDLDNYEFKDLKKRNGTLANENYQINKRLNQTVSRLENIRYKYLEVKKDYSYVME
VFDEKTKDLKEQINQLSMERDDLSTRRENLKTKLKSCKDELLMLNQNQTILQNKYDTVVN
ECDIWKNNYQTLELESTKLKDELKLKDTELNSISSQLNEIDRHMSELGDENVRLKNENES
LNSNLKIIEEKLHSKKSEVDQLNKTIEESLETQRINETSKNLKEEYETLLLEKEELEKKT
NEQIEEHNRTIFELRNDITAKENEFKDLQDTKNEIQEQLETKTKELEELKIQYEDVNDDA
NIKGAEVSELCEDLKELKESKTYLEGTISKLETVVDEWKTKYETQTTELKKVTVELESLQ
LRNSDIEAEHLKELEHLHVNMSSLQEMLKDHSTTITELQEENENLKKMLKDSKTLFHENK
EENGEGEGEAPENNDENNIDKREIESLKKEVEEWKEKYNTHEKDTNKRLKLLAEDLYIQY
SSKHEQKVKLLKKGYENKYQGELSRLNLQNSGLIEELEQLNKQLTAERKEKQDLIKMLDD
KSKLID
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggaattcaacatgaatgatggggagcaattaccaaccacaccaatcagacaagtctct
gatatttcccaaattgcacatggtgaaaagaggtcacttgaagacaatcagttagatggc
aattcttcagaacttatagtccatttacatggcttaccatctcggagaaaaagcatccgc
ttacctgaactagaagaggcaaatgccgtatcaccatctataaataaagataatagatca
cacgagaatggtaacaatagtatagtcgatgtgtccgaagatatgtccttagacttcaac
agaggaacgaatgacgataaaacatcaccaacaaaatcaactttagaaaatcttgacata
aataaactatttgcctcttcaaataacgctagtaataatcataatgataatgatcaaaat
accaatggtgataagatatcagaatccaaacttttaaaccattctccaattaaattagaa
ttaagctctccaatgaaacaaatggaccaagcagaaaacgcagatgagaatgaaactgct
aatgataatagtcatgttagaaagaaattgaaattagatagagaatcagttccaaaccta
acacaacaattaaataataatgagatggaaatgggtgggacatcaccaagccccattgaa
atgattgatatgcaaataagccccattaaatcatcgttatctcctatacagaggactcca
ccacatcgtagtaatgatgaaccacaacgagatgatgagaataacaatgccgccgataat
aataacactactaataaccatatatctagtgcacatcaacttactccactttacgatatt
gataaccatagggaggatggaggaaccaaagagcaggggcttggaaatgatgacgttgaa
gatgaaaatgaagatgaagatttagataattatgaattcaaagatttaaaaaaaagaaat
ggaacattagctaacgaaaattatcaaatcaataaaagattaaatcaaacagtatcacga
ttagaaaatattagatataaatatctagaagtaaaaaaagattattcttatgttatggaa
gtatttgatgaaaagacaaaagatttgaaagaacaaattaatcaattatcgatggaacgt
gatgacttaagtacaagaagagaaaatttgaaaacaaagttgaaaagttgcaaagatgaa
ttattaatgttaaatcaaaatcaaactattttacaaaataaatatgatactgtggttaat
gaatgtgatatttggaagaataattatcaaactttggaattagagtccacgaagttgaaa
gatgagctcaaattaaaggatactgaattgaattctattagttctcaattaaatgaaata
gacagacatatgtcagaattgggagatgaaaatgtaagacttaaaaatgaaaatgaatca
ctgaattctaatttgaaaatcatcgaagaaaaattacattcaaaaaaatcagaagtggat
caattgaataaaacaatagaagagtcattagaaacacaaaggattaatgaaacaagcaaa
aacctcaaagaggaatatgagactttattgcttgagaaggaagagctagaaaagaaaact
aacgaacaaattgaagaacataatagaaccatatttgaacttcgaaacgatataacggca
aaggagaacgaatttaaagatttacaggatacgaagaacgagatacaagaacaattagaa
acaaagacaaaagaactagaggaactgaaaattcagtacgaagatgttaatgatgatgca
aacattaaaggtgcagaagtttctgaattgtgcgaagatcttaaagaattaaaggaatct
aagacatacttagaaggaaccatttctaaattagaaactgtcgttgatgagtggaaaaca
aaatatgaaactcaaactacagaactaaaaaaagttacagtggaattggaaagtctacaa
ttaagaaatagtgacattgaagccgagcatctcaaagaattagagcatcttcatgttaac
atgagttctctacaagaaatgttgaaggatcactctaccaccataacagaattacaagaa
gaaaatgagaatctgaaaaagatgttaaaagatagtaaaactttgttccatgaaaataaa
gaagaaaatggagaaggagaaggtgaagctcccgaaaataatgatgaaaacaacatagac
aaaagggaaattgagtcgctcaaaaaggaagtagaagaatggaaggaaaaatacaataca
catgagaaggataccaacaaacgtttaaagcttttagcagaagatctgtatattcaatat
tcatcaaaacatgagcaaaaagtgaaactgttgaaaaaaggttatgagaataaataccaa
ggagaattgtcacgtctgaatctacaaaattcaggcttaattgaagagcttgagcaatta
aacaaacaattaacagcagagcgcaaggaaaaacaagacttaataaagatgttggatgat
aaaagtaaattgatagattga

DBGET integrated database retrieval system