KEGG   Naumovozyma dairenensis: NDAI_0F01710
Entry
NDAI_0F01710      CDS       T02234                                 
Symbol
NDAI0F01710
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04111  Cell cycle - yeast
ndi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0F01710 (NDAI0F01710)
   04113 Meiosis - yeast
    NDAI_0F01710 (NDAI0F01710)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ndi03400]
    NDAI_0F01710 (NDAI0F01710)
DNA repair and recombination proteins [BR:ndi03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    NDAI_0F01710 (NDAI0F01710)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 11496828
NCBI-ProteinID: XP_003670733
UniProt: G0WCH9
LinkDB
Position
6:417028..418794
AA seq 588 aa
MSFKAVITNPEKHALWCRILYVLSTIDEVIKITISDKELIAWSINSTDTTLCQIHFSRQF
FEEFNFEPNEIVFGVNGLQSKRDVQGTDQKLYSFQINGRHLTTISKKPDNDSIRNFTIVL
NNSSSCPETLVDRLLIRMEMESLIVKEYSPQIDPIQFDPIIIDLKYKSRFLDVFGTTAIT
SNANSQLDPRLLEIFRSIQQELEASLFNGEIEYGIRQKDQLTEADEINYICCDRILLSNI
LDNATNSITELKLEINPNKLNMTGFTKAIYGKDNDLLRNAMSVTNTINTLDLEHSCLFTA
VSGDRKKVQESSKSIIFKLKDFKSFMSISSNSKSLPNNADILNLWFCRPGDPVLFEMKKM
GVRMELVQTTDGIQTNNFVQDQNIRQVISPKKGTLQQETKEIKKQEYPFRDEAPGKSTRE
KRKLLDPNVTKPSLLHPSNPTPKQLNIPPKRELFVQDISQGNVKRTAACSLREEVTGKQN
VKSRKLRAMFEPPSEYDPPVSQNEPVDVLRRSPDRNMLAERSTTTIGWGKTDSTKEYVNI
DARDMLKDEKIKLLQHDVTELKKQSSQEGNHMSEFGPTQVTQPRGLLD
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcgtttaaagcagtcattacaaacccagaaaaacatgccctatggtgccgtatactt
tacgttttatccacaattgatgaagttatcaaaattactatttctgataaggaactgatt
gcatggtctatcaactctacggataccacattatgtcaaattcacttctcacggcagttc
ttcgaggagttcaatttcgagccgaatgaaatagtctttggagttaatggtcttcagtca
aaaagagacgtacaaggtactgatcagaaactttattccttccaaattaacggtaggcat
ttaactaccatatccaagaagccagataacgattcgatcaggaacttcacaattgttctt
aacaactcgagcagttgccccgaaacactagtcgataggcttctgatacgtatggaaatg
gagtcattaattgttaaggaatactcaccacagatagatcctatccagtttgacccaatt
attattgatctgaaatataaaagtcgatttttggacgtgtttggtacaacagcgataacg
agcaacgcaaattcacagttagacccccgattacttgagatatttagatctattcaacaa
gaactagaggcttctttattcaacggggaaatagaatatgggatacgccaaaaagatcag
ttgaccgaagctgatgaaattaactatatttgttgtgaccgcatactattgagcaacatt
ttagataacgctacaaattctataactgagcttaaattggaaataaacccaaataaattg
aacatgacaggatttacaaaggctatatatggtaaagataatgatctacttcgaaatgct
atgagtgtaaccaataccatcaatacattggatttggagcattcttgtctatttacagct
gtcagtggtgaccgaaaaaaagtacaagaatcttcgaagagtattattttcaaattaaag
gattttaaaagttttatgtctatttcctcgaatagcaagtcattaccaaataatgctgac
atactcaatctttggttctgccgaccaggagatcctgttctattcgagatgaagaaaatg
ggcgttcgaatggaattagtacaaactactgatggtattcaaaccaataattttgtccaa
gaccagaatatcagacaagttatttcaccaaagaaaggaactttgcaacaagagacgaaa
gaaatcaagaaacaagagtatccatttcgtgacgaggcgccaggtaaaagcacaagggaa
aaaagaaaactattagatccgaatgtaacaaaaccttcgttgcttcaccctagcaatcca
actccgaaacaactcaatataccaccgaagcgagaattattcgtacaagatatatctcag
ggaaatgtcaagagaactgcagcctgctctttacgagaggaggtaaccggaaaacagaat
gtgaaatcgagaaaattgagagcgatgtttgaaccgccatccgaatatgatcctcccgtg
agccagaacgaacctgtggatgtactgaggagaagtccagataggaacatgctagcggag
agaagtaccactacaattgggtgggggaaaacagattctaccaaggaatacgtcaatata
gatgctcgagatatgctgaaagatgaaaaaatcaaactgttacagcatgacgtaaccgaa
ttgaagaaacaatcatcccaggaaggaaaccatatgtctgagtttggtccgacacaagtg
acacaaccacgtgggttattggattga

DBGET integrated database retrieval system