KEGG   Naumovozyma dairenensis: NDAI_0G04740
Entry
NDAI_0G04740      CDS       T02234                                 
Symbol
NDAI0G04740
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04111  Cell cycle - yeast
ndi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0G04740 (NDAI0G04740)
   04113 Meiosis - yeast
    NDAI_0G04740 (NDAI0G04740)
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 13926936
NCBI-ProteinID: XP_003980134
UniProt: J7SB10
LinkDB
Position
7:1135051..1136850
AA seq 599 aa
MSTQNTRKQTIPIIDLDKISQEDELLPVVRSILLYTDTFLLKNYANKSSLDSLISHLNDS
NNAPDTKQQFDANFTGTLSINNDISMEQYIYNSEPDLQFNRTVNNPYLQKLSSRLFKVSL
FFSQLCLKSIVQNTTLQNTLSETNFATKLTRYHHERGNLEKVSVNGEDFQYLFNHDFINH
TSAGILTVFPIAKGIKYKPPTASIDDNQWTSIDEPDCLLFHTGTLLSTLSNGLHSTSPIQ
IDPSTNPIHLTIFPPLSTPLNGNKKVSAELLSQQIKEFPQVAEKFYNKQSHQLILQQKLN
LYKRLFTTSETILSLNSMSRVSNIAPELHSLLPQMSNMMNFKIVQDDFLKLLTIWPQAYI
IEANSKCELAIKLPQIDPLMALSNKSRKLQFAEMCDLWYLNHYDLDVVPKDVPPLKVNKR
RGSIDNDNMDVSSPSYQTKRIQSPTKQKNYIHNKKEQFIYKEKQHDSQSNLLDRLRERER
RSAALLSERQRKYQEFLSVKMSQVFKILISLNWNEPYTVTHLTELIADSLQNSNNPIGEY
EAEEIIDKLQSLLSDQISCIVVEGGLKVYKWDQLKSDKFESALNEFKEKAHETNIHMDV
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgtcaacccaaaatactagaaaacaaacgatacccattatcgatctagataaaatctca
caagaagatgaactcttaccagtggtacgatctatattattgtacactgacactttctta
ttgaagaattatgctaataaatcctcgttagattcattaatctcacatctaaatgacagt
aataacgcccctgataccaagcaacaattcgatgctaatttcacaggaactttatccatt
aataatgatatatcaatggaacaatacatttacaattctgaacctgatttgcaatttaac
agaactgttaacaacccttatttacaaaaattatcttcaagattatttaaagtcagtcta
tttttctcccaattatgtttgaaaagtatagtacaaaatacaactttacaaaatactctt
tcagaaaccaacttcgcaacaaaattgactaggtatcatcacgaaagaggtaacttagaa
aaagtctcagtaaatggcgaagatttccaatatttgttcaatcatgattttattaatcat
acttcagcaggtatattaactgttttccccattgcaaagggtattaaatataagccccca
actgcaagtatagatgataatcagtggacttccattgatgaacccgattgtttattattt
catacaggaactcttttaagtacattgtccaatggacttcactccacatctccaattcaa
atagatccgtcaacaaatccaatccatttgactatatttcctccacttagtacaccatta
aacggaaacaagaaagtctcagctgagctattaagtcaacaaataaaagaatttccacaa
gtcgcagaaaagttttacaataaacaatctcaccaactaatattacaacaaaaattaaat
ctctataaacgtttattcaccacatctgagactatcctatcattaaattcaatgtctaga
gtaagtaacattgctcctgaattacattctttattaccacaaatgtcaaatatgatgaac
tttaaaattgtccaagatgatttcttgaaattattgactatttggccccaagcatacatc
attgaggcaaattcaaaatgcgaattggctataaaattacctcaaatagatccattaatg
gctttatccaataaatcaagaaaattacaattcgcagaaatgtgtgacttatggtatcta
aatcattacgatctggatgttgtccctaaggatgtaccgcctcttaaagtaaataaaaga
cgtggaagtattgacaatgacaacatggacgtatcgtcaccatcatatcaaacgaaaaga
attcaaagtcctacaaagcagaaaaattacatccataataagaaggaacaattcatctat
aaagagaaacaacatgattctcaatccaatttattagatagattaagagaacgtgaaaga
agatccgctgcattattatctgaaagacaaagaaaatatcaagaatttttatccgttaag
atgtcacaagttttcaaaattttaatctcattaaattggaatgaaccatacacggtaact
catttgactgaattgattgcggatagtttacaaaatagtaataatcccattggtgaatat
gaagcagaggaaattattgataaattacaatctttattaagtgatcaaatttcttgcatt
gttgtggaaggtggattaaaagtttataaatgggatcaattgaaatctgacaaatttgaa
agtgctttgaatgaatttaaagagaaggcacatgaaactaatattcatatggatgtataa

DBGET integrated database retrieval system