KEGG   Naumovozyma dairenensis: NDAI_0H01130
Entry
NDAI_0H01130      CDS       T02234                                 
Symbol
NDAI0H01130
Name
(RefSeq) hypothetical protein
  KO
K06646  G1/S-specific cyclin CLN3
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04111  Cell cycle - yeast
ndi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0H01130 (NDAI0H01130)
   04113 Meiosis - yeast
    NDAI_0H01130 (NDAI0H01130)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 11495818
NCBI-ProteinID: XP_003671530
UniProt: G0WES6
LinkDB
Position
8:complement(253798..255708)
AA seq 636 aa
MNSTTHQAEQIGSYNNNNNSNNSNNSNNNNNNNNNNNINNHATNSRGNNFTTSANATSNY
PNMMMLSQIRRNNATIKSQTPNLVLRELQCHHSSIIEYGPQHLTHLLDLKNFQEFKINIL
NFQTQPQINSKMRFLIFDFIFYSHTRLNLSASTLFLAFDILDRYASKYIIKSCDYQLLAL
TALWISSKFWDAKNRCATLKVLQSLCCNQYSVTQFKKMEFHLLKALNWSLCSSPTFDSFI
DLLLFMENNMDPASSSNTNTMISEIKSLKSSINVNEVKLGTLMLCELIAFDENSSFNYDN
YSIAQTGIKLIILALNYHDSNKWENFNDLDNHPSVFNNDIAKSLLNLITNEDQYPSTFKF
KYLGDQTSPPQQQQGQAGKGHKRNPSAFTRLKVSNKILLALKKYQYQLQLDEFYQSQEFQ
LALTNFNDINIQTPSMDDFCINNIPINESNSSSFFIGRKFSNDGRKSIAASISSSSSFAS
SSSFTSTSSSCFSSASSPTPMSSPNKMNSNPIPSETPCPIAPSPLRRQTLTIPHMYPPSN
ISSLQPLTPTTPSLFMTTNNTKLKFPTAMMMNDKHGHISHHDRRISLQLKGASISSSIPF
MKGHRKRSSSSMDVAFNDANDFKGYKRVYSQNNTSK
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaattcaacgacacatcaagctgaacaaatcggcagttacaacaacaacaacaacagc
aacaatagcaacaacagcaacaacaacaacaacaataataataataataatattaataac
catgctacaaattccagaggaaacaacttcacaactagtgctaatgctacttctaattat
cctaatatgatgatgctctctcaaataagacggaataatgccacaattaagtcgcagact
cctaatttagtattacgtgaattacaatgtcatcattcttccattatagaatatggtcct
cagcatttaactcatttattagatctgaaaaatttccaagagtttaagattaatatcttg
aattttcaaactcaacctcaaattaattctaaaatgagattcttaatattcgatttcatc
ttttatagtcatacaagattaaatctgtctgcatccactttatttttagctttcgatatc
ttagatagatacgcatctaaatacataattaaaagttgtgactatcaactattggcctta
actgctctttggataagttccaaattttgggatgctaaaaatcgttgcgctacgttaaaa
gttttacaaagtctatgttgtaatcaatattcagtaacgcaatttaaaaagatggagttc
catcttttaaaagcgctaaattggtctctatgctcatcacctacttttgattcattcatt
gatcttctattattcatggaaaataatatggatccagcatcgtcttcaaacactaataca
atgatttctgaaattaaatctttgaaatcaagtataaatgtcaacgaagttaaactaggc
acactaatgttatgtgaattaatagcatttgatgaaaattcatcatttaattatgataat
tattcaattgcccaaactggaatcaaattaattatcttggcactaaattatcacgattca
aataaatgggaaaattttaatgatcttgataatcatccttcagtattcaataacgacatc
gctaagtctcttttgaatttaataacaaacgaagaccaatatccttcaacctttaaattc
aaatatctaggagatcaaacatcaccaccgcaacaacagcaaggtcaagcaggtaaaggt
cacaagagaaatccatccgcttttactagattaaaggtaagtaataaaatattactagct
ttaaaaaaatatcaataccaattacaattagatgaattctatcaatctcaagaattccaa
ttggcattaaccaattttaatgatataaatattcaaactccttcaatggatgatttttgc
attaacaacataccaatcaacgagtcaaattcttcttctttctttattggaaggaaattt
agtaatgatggaaggaaatctatcgctgcatctatatcatcctcctcatcgtttgcgtca
tcgtcatcgttcacgtctacgtcctcatcatgtttttcttcagcatcttcaccaactcca
atgtcatcacctaataaaatgaactccaatccaattccttcagaaaccccatgcccaatt
gctccatcaccgctaagaagacaaacattaacgatcccacacatgtatcctccatcaaat
atatcttctttacaaccattaactccaacaacgccttcattatttatgacaacgaataat
actaagttgaagttccccacagcaatgatgatgaatgataaacatggacatatttcccat
catgatagaagaatatcattacaattgaaaggagcaagtataagtagttcaattccattc
atgaagggtcatcgcaagagatcttcatcatcaatggacgttgcttttaatgatgcgaac
gatttcaaaggttataaacgtgtatatagtcaaaataatacaagtaagtaa

DBGET integrated database retrieval system