Neisseria dentiae: H3L92_04990 Help Entry H3L92_04990       CDS       T07671                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ndn  Neisseria dentiae Pathway ndn02024   Quorum sensing ndn03018   RNA degradation Brite KEGG Orthology (KO) [BR:ndn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     H3L92_04990 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     H3L92_04990 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ndn03019]     H3L92_04990 (hfq)    03036 Chromosome and associated proteins [BR:ndn03036]     H3L92_04990 (hfq) Messenger RNA biogenesis [BR:ndn03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      H3L92_04990 (hfq) Chromosome and associated proteins [BR:ndn03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     H3L92_04990 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QMT46130 LinkDB All DBs Position complement(1055982..1056266) Genome browser AA seq 94 aa AA seqDB search MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHA ISTIVPARAVSLQHEHKQSQAAAPVQVETQQAAE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccgctaaagggcaaatgttacaagatccttttttgaacgctttgcgtaaagagcac gtgccggtttccatttatctggtaaacggcatcaaacttcaggggcaggttgaatcgttc gaccaatatgttgtgttgttgcgcaacacctcggtaacgcaaatggtttacaaacacgcc atttccaccattgttccggcacgcgcggtgagcttgcagcacgaacacaaacaatctcag gccgcagcccccgttcaagtggaaacccaacaggctgccgaataa

DBGET integrated database retrieval system