KEGG   Neorhizobium sp. NCHU2750: NCHU2750_55550
Entry
NCHU2750_55550    CDS       T05650                                 
Symbol
noxA
Name
(GenBank) D-nopaline dehydrogenase
  KO
K24952  nopaline oxidase subunit A
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00330  Arginine and proline metabolism
nen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NCHU2750_55550 (noxA)
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD NAD_binding_8 DAO FAD_oxidored SO_alpha_A3 FAD_binding_2 HI0933_like Thi4 Lycopene_cycl NAD_binding_9 FAD_binding_3 AlaDh_PNT_C Pyr_redox_3 GIDA
Other DBs
NCBI-ProteinID: AYD04923
UniProt: A0A386EA26
LinkDB
Position
pTiNCHU2750:complement(31942..33360)
AA seq 472 aa
MNPNSSADLLIVGAGPAGMAAARRAVRGGLSVVLLDSQSQPGGQIWRNAGSNATSPVINV
LGAEYRRGIRQIEAFLASGADYIPEAQVSRLSQGWTVEYVKGGEIRSVMGRHLLLAMGAQ
ERPVPFTGWTLPGIMTVGAAQILLKTAGQLPRGPVAVVGSGPLPLLYMQQMRLAGTKPVA
YLDTTPRGLISRSLRGFRGALKEPGQILKGIAWLPQFSGVRHVRNVVKISAEGSGRLETV
RFETSNGRSDRLEVKSLLVHEGLVPSHQLAVSVGAQLMWDVGQSAFRLERDEWMNAGPDG
LYIAGDGARIGGAVNAEIEGEIAATGILLRDGALTAAQANTETKPLRAQHGRQKSFRRFL
DGAYPPNIARTQPDDETIVCRCEELSAGVLREAAVRGACRGPNQLKSFTRAGMGPCQGRQ
CGYPVHELVKSVAGLTAGEVGLFNPRPPFVPLTVSMLAAQQAEEVVSASIHE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaacccgaattcgagcgccgacctgttaatcgtcggagctggccccgctggcatggcc
gccgcgaggcgagctgtgcgcggcggcctatccgtcgtcttgctggattcgcaatcacag
cccggaggtcagatctggcgtaatgccggcagcaacgcgacgagcccggtcataaacgtt
ctgggggcggaatatcgacgcggcatccggcaaatcgaagcattcctggccagcggcgcc
gactacattccggaggctcaggtaagcaggctcagccagggttggacggtggaatatgta
aagggtggagaaattcgttctgtcatgggacggcatctcttgctcgctatgggcgcacag
gaacgcccggttccgttcaccggctggacgctacccggcatcatgacggtcggcgccgca
cagattctccttaagacggcgggccaactgccacgggggccagttgccgtggtcgggagc
ggacctcttcccctactatacatgcagcagatgcggctcgccgggacaaagcccgtcgct
tatctcgatacgacccctcggggtctcatcagccgttcgctgcgcggttttcgcggggcg
ctaaaggagcccggccaaatcctgaaagggattgcctggttaccgcagttcagtggcgtt
cggcacgtacgcaacgtggtcaaaatcagcgccgaaggaagcggacgactggaaactgta
cggttcgaaacttcaaacggcaggtccgaccgattggaggtcaaatcccttcttgtacac
gaggggctggtgccaagccatcagttggccgtgtcggtcggcgcgcaactgatgtgggat
gtcggccagtcagcgttccggcttgagcgcgacgagtggatgaacgcaggtccggacgga
ctgtacatagccggggacggtgctcggatcggcggcgccgtcaatgccgagatcgaagga
gagatcgccgcgaccggtatccttcttcgtgacggcgccctgacggccgctcaggcgaat
accgagacaaaaccgctgagagcacagcatggccggcaaaagtcgttccggcgatttctg
gatggggcctacccgccgaatattgcgcggacccagccggacgacgaaacgatcgtctgc
cggtgcgaggagttgagcgcgggcgtgttgagggaagctgctgtccgtggcgcttgccga
ggccctaaccagctgaagagttttacacgcgcgggcatgggtccctgtcagggaaggcag
tgcggctacccggtgcacgaactggtgaagtccgtcgccggtctgaccgctggcgaggtc
ggcctgttcaatccgcggcctcccttcgttcccttaacggtatcgatgcttgcagctcag
caggccgaggaagtcgtttcagcgtcgatacatgagtga

DBGET integrated database retrieval system