KEGG   Aspergillus fischeri: NFIA_093400
Entry
NFIA_093400       CDS       T01070                                 
Name
(RefSeq) dimethylallyl tryptophan synthase, putative
  KO
K18279  verruculogen prenyltransferase [EC:2.5.1.107]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00404  Staurosporine biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00786  Fumitremorgin alkaloid biosynthesis, tryptophan + proline => fumitremorgin C/A
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    NFIA_093400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nfi01006]
    NFIA_093400
Enzymes [BR:nfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.107  verruculogen prenyltransferase
     NFIA_093400
Prenyltransferases [BR:nfi01006]
 Compound prenylation
  Indole prenyltransferase
   NFIA_093400
SSDB
Motif
Pfam: Trp_DMAT
Other DBs
NCBI-GeneID: 4587832
NCBI-ProteinID: XP_001261274
UniProt: A1DJ20
LinkDB
Position
Unknown
AA seq 453 aa
MTIHPQNHDLPTGSAMKATPFEALDLVFHFEDQAQRQWWKQAGPVLGQHLLLANYDINKQ
YQYLCFFGHHIIPILGPGPGSGYDYHPLEISQNFQRSGSTIRLGFQPRAYSSCVSPQDPF
GELSTEEAMARLGQVTGVELDLQPYHLLASHLNLTKKEEKEMLQPTCYNSLSPSFKTQGL
LAVELPRTGSITLKGYWFLSAKSMVTKTPISELSFQAFRNIDHGKDLLVPALRPIEEYFA
EMKMKPANPTTPQTTEFATVACDHVDMSRTRFKLYLYECLWKYDRLADIYTLGGRLKNAP
GIAEGLELLREIWSILQIPEGYHFASLQNSLLRKSTNAESCGEASKPASEEREFFDDQAL
IFNFEIRPGEKWPQPKVYFPLAYLTDSKAADAVVALFEKLGWKEEARRYKDNLKTYYPRC
DLDKTSGLQHVLSFSYRPKTGPYTTVYYWKIGA
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgactatccacccacaaaatcacgacctgcccacgggatccgctatgaaggcaacacca
ttcgaagccctagatcttgtttttcattttgaggaccaagcgcagcgtcagtggtggaaa
caagcaggtcctgtcctaggacagcacctcctgcttgccaactacgatatcaacaagcaa
taccagtacttatgcttctttgggcatcacattatacctattttgggtcctggaccaggc
agcggctacgattatcatccactggaaataagccaaaatttccagaggtcaggaagcacc
atacgtctcggattccagcccagagcctactccagctgtgtgagccctcaggaccccttc
ggcgagctatcgaccgaagaggcgatggccaggcttggccaagtgactggtgttgagctg
gacctacagccgtaccacctgcttgcaagtcacctcaatttaactaagaaagaggaaaaa
gagatgttgcaacctacctgctacaatagtctatcaccttctttcaagacacagggttta
cttgccgtggagctcccccgtactggcagcataacactgaaaggatattggtttctatca
gcaaagtccatggtcaccaaaaccccaatctctgaactttcctttcaggcgtttcggaat
attgatcatggaaaagacttgttggtacctgctttacgtcctattgaagaatactttgca
gaaatgaagatgaaacctgcaaaccccactacaccccagacaaccgaatttgccaccgtg
gcttgtgatcacgttgacatgtcccgaactcgattcaagctctatctttatgagtgcttg
tggaaatatgaccgacttgctgatatttacacgctggggggccgactcaagaacgcccct
ggtattgctgaggggctagagctactgcgtgagatatggtctattcttcagattcccgaa
gggtatcattttgcgtcccttcagaattccctcttgaggaaaagcacgaacgccgagtct
tgcggtgaagctagcaaaccggcatctgaggagcgtgaatttttcgatgaccaagcgctg
attttcaactttgagatccgtcctggagaaaaatggccgcagccgaaggtatactttcct
ctagcatacctgactgacagcaaagccgccgatgcagtagtggctttatttgaaaagctt
ggatggaaagaggaggcacgcagatacaaggataatttaaaaacatattaccctaggtgt
gatcttgacaaaacatccgggttgcagcatgttctatctttctcatatcgtcctaaaact
ggcccttatacaacagtgtactactggaaaattggcgcttag

DBGET integrated database retrieval system