KEGG   Natronobacterium gregoryi: Natgr_2452
Entry
Natgr_2452        CDS       T02383                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family protein
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00053  Ascorbate and aldarate metabolism
nge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Natgr_2452
Enzymes [BR:nge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     Natgr_2452
SSDB
Motif
Pfam: Epimerase NAD_binding_10 NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD GDP_Man_Dehyd KR DapB_N NmrA Sacchrp_dh_NADP adh_short Semialdhyde_dh
Other DBs
NCBI-ProteinID: AFZ73617
UniProt: L0AKD8
LinkDB
Position
2390598..2391404
AA seq 268 aa
MTDVAITGASGRVGRETIEALSDEGFELTLFSHSETDDLETTTLEVADYEAVVDALVGQD
VVVHLAANPDPRAEWRSVREPNIDGAYNVYEAAAETGVERVVFASSNHAVNMDNAVSGDR
PESTVDEPDVVRPGDVADPDTYYGVTKAFGEALGSYYAKRHGIDVVALRIGWLLTRDELR
SEIEDRDDAGERYARAMWLSPADCQRLMAAAVTVPLEQTLTTAHGISNNTRRFLSLTETM
IELGYRPRDDSADVLEGDGGRQGSLETG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgacggacgtcgcgatcaccggtgcgtcgggacgtgtcggcagggagacgatcgaagcg
ctctctgacgagggcttcgagttgacgcttttttctcacagcgagactgacgacctcgag
acgacgaccctcgaggtcgccgactacgaggcagtcgtcgacgcgctcgtaggacaggac
gtggtggttcatctcgcggcaaatcccgatccgcgtgcggagtggcggagcgtcagggaa
ccgaatatagacggcgcgtacaacgtctacgaggccgcggccgaaaccggcgtagagcgg
gtcgtcttcgcgagttcgaaccacgcagtcaacatggacaacgcggtgtcgggggaccgg
ccggagtcgacggtcgacgagccagacgtggttcggcccggcgacgtggccgatccagac
acctactacggtgtcacgaaagccttcggcgaggcgctggggtcctactacgcgaaacgc
cacgggatcgacgtggtcgctttgcggatcggctggctgctcactcgcgacgaactccgt
tcggagatcgaagatcgcgacgacgctggtgagcggtacgctcgagcgatgtggctcagt
ccagcggactgccagcggctgatggccgcagccgtgactgtcccgctcgagcagacgctg
acgactgcccacggcatctcgaacaacactcgccggttcctctcgctgaccgagacgatg
atcgagttgggctatcggccgcgagacgactcggctgacgtgctcgagggtgacggtggg
agacaggggagcctcgagacggggtag

DBGET integrated database retrieval system