KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726315
Entry
103726315         CDS       T03372                                 
Symbol
Itgax
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04610  Complement and coagulation cascades
ngi04810  Regulation of actin cytoskeleton
ngi05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103726315 (Itgax)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    103726315 (Itgax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103726315 (Itgax)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ngi04515]
    103726315 (Itgax)
   04090 CD molecules [BR:ngi04090]
    103726315 (Itgax)
Cell adhesion molecules [BR:ngi04515]
 Integrins
  Integrin alpha subunits
   103726315 (Itgax)
CD molecules [BR:ngi04090]
 Proteins
  103726315 (Itgax)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VWA_CoxE Integrin_alpha FG-GAP_2 VWA_3
Other DBs
NCBI-GeneID: 103726315
NCBI-ProteinID: XP_008822010
LinkDB
Position
Un
AA seq 1159 aa
MSSTCTALFLMMAFMPSLSFNLDTERPTNFHMDSAGFGHSVVQYGNSWVVVGAPKEIKAT
NQIGGLYKCGYSTGTCEPIHLQVPPEAVNMSLGLSLAAATNPSSLLACGPTVHHTCRENI
YLTGFCFLLGSSFLKDQRFPAALQECPRQEQDIVFLIDGSGSISSNNFKTMLDFVKAVMN
QFQRPNTQFSLVQFSNRFQTHFTFSDFISSPNPLNLLNSVYQLFGTTHTATAIQHVIMHL
FTAQNGARKDATRILIVITDGRKEGDHLDYKDVIPTAEKAGIIRYAIGVGRAFHHAHSWQ
ELNNIASKPSQDHIFSVDNFGALKDIQNQLKEKIFAIEGTETVRSSSFELEMSQEGFSAV
LTPDGPVLGAVGSFSWSGGVFLYPPNMRPTFINMSQENVDMRDAYLGYSTELAFWKGVYS
LVLGAPRHQHTGKAVIFTQESRQWRPKSEVRGTQIGSYFGASLCSVDMDRDGNTDLVLIG
APHYYEQTRGGQVSVCPMPRGRSRWQCEATLHGEQGHPWGRFGAALTVLGDVNGDSLTDV
AVGAPGEQENRGAVYIFHGASKLVIGPSPSQRITGSQFSSRLQYFGQSLSGGHDLTQDGL
VDLAVGSQGRVLLLRTRPILRMLVAMHFLPAEITRSVFECQEQVTSVRALSNVTVCLQIY
ESPKTQLGDLQSSVTFDLTLDPGRMHPRAIFQETKTRALTRVQHLDLNQHCETMKLLLPA
CVEDSVTPITLRLNFSLIGMPMSSFQNLQPMLAADAQTYFTASLPFEKNCGDDHVCQDDL
GVTFGFSGLKTLIVGNDLELHVDVTVSNDGEDSYGTMVTFFYPEGLSFRKVAKGKSQTQQ
RSLHLTCDSAPGRSQGTWGTSCSISHVIFRGGTQMTFLITFDVSPKAALGDHILLIANVS
SENSISRTSKTTFQLELPVKYAVYALISSHEQSTKYLNFSASEEKGSSIVEHRYQVNNLG
QRDVPVSITFQVPVELKGEAVWTVAISHPQNLSIQCSADKIEPTQSDFLTHMQGRPVLDC
SIADCLWLHCDIPSLGSQEELDFILKGNLSFSWVSQTLQKKVLVMSVAEISFNTSVYSQI
PGQEAFLRAQLKTVLEKYEVPNLIPLIVGSSVGGLLLLALITATLYKTGFFKRQYKEMME
EANGQVVPENGAPDHQVSQ
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgagcagtacctgcacagccctctttctgatgatggccttcatgccttctctcagcttc
aacctggatacagagcggccgacaaacttccacatggacagtgctgggtttggacatagc
gtggtccagtatggaaactcctgggtggtggttggagcacccaaggaaataaaggccact
aatcaaataggtggcctctacaaatgtggctacagcacaggcacatgtgagcccatccac
ctgcaggtgcccccagaggctgtgaacatgtccctgggcctgtccctcgctgctgccacc
aatccctcctcgctgctggcctgcggtcctaccgtgcaccacacgtgcagagagaatatc
tacttgactgggttctgctttctgctgggctcatccttcctgaaggatcaaaggttccca
gctgctctgcaggagtgtccaaggcaggaacaggacatcgtgttcttgattgacggctca
ggtagcatttcttccaacaattttaaaacaatgctggactttgtgaaagctgtgatgaac
cagttccagagacctaacacacagttctccctggtgcagttctccaaccgtttccagaca
catttcactttcagtgacttcatctccagtccaaaccctttaaacctcctgaattctgta
taccaactgtttgggacaacgcacacagctacagctattcagcatgtcataatgcacctg
ttcactgcccaaaatggggcccggaaagatgccactaggatcctcattgtcatcactgat
ggaaggaaagaaggtgaccacctggattataaagatgtcattcccacagcagagaaagca
ggcatcatccgttatgcaattggggtaggaagggcttttcaccacgctcattcctggcaa
gaattaaataacattgcatcaaagccttcccaggatcacatattcagtgtggacaacttt
ggtgctttgaaggatattcaaaaccagctgaaggagaagatctttgccattgagggtaca
gagacagtaagaagcagttcttttgaactggagatgtcccaggagggtttcagtgctgta
ctgacacctgatggaccagttctgggggctgtgggaagcttcagctggtctggaggtgtc
ttcctgtatcctccaaatatgagacccaccttcatcaacatgtctcaggagaatgtggac
atgagggatgcttacctgggttactccactgagctggccttttggaagggggtctacagc
ctggtcctaggggcccctcgccaccagcacaccgggaaggctgtcatctttacccaggaa
tccaggcagtggaggccaaaatctgaagtcagagggactcagattggctcctactttggg
gcctccctttgctctgtggacatggacagagatggcaacacagacctggtcctgattggg
gccccccattactatgagcagacccgagggggccaggtgtctgtgtgccccatgcccagg
gggaggagcaggtggcagtgtgaggccactctccatggggagcagggccatccttggggc
cgctttggggcggctctgacagtgctgggggatgtgaatggggacagcctgacagatgtg
gctgtcggtgcacctggagagcaggagaaccggggtgctgtctacatatttcatggagcc
tcaaaactggtcatcggtccctcacccagccagaggattacaggatcccagttttcctcc
aggctccagtattttgggcagtctttgagtgggggtcatgacctcacccaggatggactg
gtggacctggctgtggggtcccaggggcgtgtgctgctgctcaggaccagacctatcctc
aggatgttggtggctatgcacttcttacctgcagagatcaccaggtctgtgtttgagtgc
caggagcaggtaacgtctgtccgggcattgagtaatgtcactgtctgccttcagatttat
gaaagcccaaagacccaactaggtgacctccaaagttctgtgacctttgacttgacccta
gaccccggacgcatgcatccccgtgccatcttccaggagacaaagacccgagctctgact
cgggtccaacaccttgatctgaaccagcactgtgaaactatgaagttgctcctcccagcc
tgtgtggaggactcagtgacccctatcactttgcgcctcaacttctctcttattggcatg
cccatgtcttccttccaaaacctccaacccatgctggctgcagatgctcaaacatacttc
acagcctctcttcccttcgagaagaactgtggagatgatcacgtctgccaggatgacctt
ggcgtcacctttggcttctcaggcttgaagactttgatagtggggaatgacctggagctg
catgtagatgtgacggtatccaatgacggcgaagattcctatgggaccatggtcaccttc
ttctacccagagggactgtcctttcgaaaagtagccaaaggcaaaagccagacgcagcag
cgctctctgcacctcacatgtgacagtgctccaggtaggagccagggcacttggggtacc
agctgcagcatcagccatgttatcttccgaggaggcacgcagatgactttcttgataact
tttgatgtctccccaaaagctgcactgggagatcacatacttctgattgccaatgtgagc
agtgagaatagcatatccaggaccagcaaaaccaccttccagctggagctcccagtaaag
tatgctgtctatgctttgatcagcagccatgaacaatccaccaaataccttaacttctca
gcctcagaagaaaaggggagcagtattgttgagcacagataccaggtgaataatctagga
cagagggacgtgccagtcagcatcaccttccaggtacctgtggagctgaagggagaagct
gtgtggacagtagcaatctctcaccctcagaacctgtccatccagtgctctgcagataaa
atagagcccacacaatcggacttcctgactcacatgcaggggagacctgtgctggactgt
tccatcgctgactgcctgtggctccactgtgacatcccctccctgggcagccaggaggag
cttgacttcattctgaagggcaacctcagcttcagctgggtcagccagacattgcagaag
aaggtgttggtcatgagtgtggctgaaatcagtttcaacacatctgtatattcccagatt
ccaggacaggaggcattcctgagagcccagctgaagacagtgctggagaagtacgaagtc
cccaacctgatccctctcattgtgggcagctcagtaggaggtctactgttgctggctctc
atcacagccacactgtacaagactggtttcttcaagcgccaatacaaggaaatgatggag
gaagcaaatggacaggttgtcccagaaaatggggcgccagaccaccaagtttcccagtga

DBGET integrated database retrieval system