KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747486
Entry
103747486         CDS       T03372                                 
Symbol
Tnfrsf8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747486 (Tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103747486 (Tnfrsf8)
   04090 CD molecules [BR:ngi04090]
    103747486 (Tnfrsf8)
Cytokine receptors [BR:ngi04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103747486 (Tnfrsf8)
CD molecules [BR:ngi04090]
 Proteins
  103747486 (Tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6 TMEM119
Other DBs
NCBI-GeneID: 103747486
NCBI-ProteinID: XP_008848175
LinkDB
Position
Un
AA seq 480 aa
MYCSTQAANSCARCSPHSTCPTGKVVKFPGTAEKDTECEWPSPGTRSDCTNPEDCEILTS
RATPQATPTPVTASIRIMQPGEGIHLSQEDTTGLLRAPKSPSSPERKPGPDPGLSLPPLC
LQGPANCRPPCEPDYYLDEAGLCRACASCSRDDLVEKAPCSWNSSRVCECRPGMFCATPA
TNSCAHCIAHPAFPLETIIRPQGMVDIDTTLELPPPGTLLDYSTPGNSEAPASISSTQSF
PVDTQTIRKQPTSTVSPFSTGTPFLDSGPAFFWVTVVLPLVVVVGSSLLLLCPWKACRKR
FRQKLHLYYPAQTSRPKLEQADSIPTGKLTQLKRSGSVTEPSTNQLSSVSPPTVETCASV
GAACLESLPLLDDGQAGIPLAPRDPPEPRVSTEHTNNRIEKIYIMKADTVIVGTVKTEVP
EGRVPVGSAGPELEAELEVDYVPHYPEQETEPPLDSCTDVMFSVEEEGKKDHWPTTVSEK
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtactgcagcacacaggctgccaactcctgtgcccgctgttctcctcattcgacctgt
cccacagggaaggtcgtcaagttcccaggcacagcagagaaggacactgagtgcgagtgg
ccttccccagggacccgttctgattgcaccaacccagaagactgcgagatacttaccagc
agggccactccccaggccacacctaccccagttaccgccagcatcaggatcatgcagcca
ggagagggcatccacctttcgcaggaagacactactggactgttgagggctcccaagtct
ccctcttccccagaaaggaaacccggtccagatccaggactatctcttccaccgctgtgt
ctgcaggggcctgccaattgtaggccaccctgtgagcctgactactacctggatgaggcg
ggcctctgcagggcctgtgcaagctgttctcgagacgaccttgtggagaaggctccatgc
tcctggaactcctcccgagtctgcgagtgccggcctggaatgttttgtgccacaccggcc
accaactcctgtgcccactgcatcgcccaccctgccttcccactggagaccatcatcaga
ccccagggtatggtagatatagataccaccttggagcttcctcctccggggaccctcctt
gactacagcaccccaggaaacagcgaggcaccagccagcatctcttccactcagagcttc
ccggtggacacccagaccatcaggaagcagcccacctccactgtctctcccttctccacg
gggacaccttttctggattcagggcctgcgttcttctgggtcactgtggtgctgccgctg
gtggtggtggttggttccagcctcttgctcctatgtccctggaaggcctgcaggaagcgg
ttccggcagaagctccacctgtactacccagcccagacttcacggcccaagttggagcag
gctgattccatacccacagggaagctgacacaactgaagagaagcgggtcagtgacagag
cccagcacaaatcagctgagctccgtgagccccccaactgtggagacatgtgccagtgtt
ggtgcggcctgcttggagagcctaccgctgctggatgatggccaagcggggatccctttg
gcccccagggatcctccagagccccgggtgtctacggagcataccaataacaggatcgag
aaaatctacatcatgaaggctgacacggtgattgtgggaactgtgaagactgaggtgccc
gagggccgggttccagtagggtcagcagggcctgagctagaggcagaactggaggtggac
tatgtccctcactacccagaacaggagacggaaccacctttggacagctgtactgatgtc
atgttttcagtggaggaggaagggaagaaggaccactggcctacaactgtctctgagaag
taa

DBGET integrated database retrieval system