Naegleria gruberi: NAEGRDRAFT_5749 Help Entry NAEGRDRAFT_5749   CDS       T01241                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ngr  Naegleria gruberi Pathway ngr03010   Ribosome ngr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ngr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NAEGRDRAFT_5749   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NAEGRDRAFT_5749  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ngr03011]     NAEGRDRAFT_5749    04121 Ubiquitin system [BR:ngr04121]     NAEGRDRAFT_5749 Ribosome [BR:ngr03011]  Ribosomal proteins   Eukaryotes    Large subunit     NAEGRDRAFT_5749   Archaea     NAEGRDRAFT_5749 Ubiquitin system [BR:ngr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NAEGRDRAFT_5749 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  8848905 NCBI-ProteinID:  XP_002677504 JGI:  Naegr1_5749 UniProt:  D2VEA1 LinkDB All DBs AA seq 70 aa AA seqDB search LFFKTLDGFGFSEQYHYLYFIKDMKPLLEKRMGVSWEKIRFIFAGKEIENERRFADYCVC KDSTVHVIKR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt ttatttttcaaaactttggatggttttggattttcagagcaatatcattatttatacttt attaaggatatgaaacccttattggaaaagagaatgggagtttcatgggagaagattcgg ttcatctttgctggaaaggaaattgagaatgaaagaagatttgctgattactgtgtctgc aaggatagtaccgtgcacgttattaaaagg

DBGET integrated database retrieval system