KEGG   Fusarium vanettenii: NECHADRAFT_97205
Entry
NECHADRAFT_97205  CDS       T01612                                 
Name
(RefSeq) hypothetical protein
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
nhe  Fusarium vanettenii
Pathway
nhe00910  Nitrogen metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NECHADRAFT_97205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nhe00199]
    NECHADRAFT_97205
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     NECHADRAFT_97205
Cytochrome P450 [BR:nhe00199]
 Cytochrome P450, fungi type
  CYP55 family
   NECHADRAFT_97205
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9669655
NCBI-ProteinID: XP_003042415
JGI: 97205
UniProt: C7ZH72
LinkDB
Position
11
AA seq 403 aa
MASEPPSFPFKRASGMEPPAEFARLRASDPVSKVKLFDGSLAWLVTKYKDVTFVATDERL
SKVRTRKGFPELSAGGKQAAKAKPTFVDMDAPDHMKQRGMVEPLFTRKHVEKLQPYIQKT
VDDLLAAMKKKGCATGPVDLVKEFALPVPSYIIYTILGVPFNDLEYLTNQNAIRTNGSST
AREASAANKELLDYLASLVDKRLEAPEDDIISKLCREQVKPGNIEKADAVQIAFLLLVAG
NATMVNMIALGVVTLFQHPEQLAKLKENPSLAPQFVEELCRYHTASALAIKRTAKVDLEI
GGKHIKANEGIIASNQSANRDADIFENPDEFNMNRRWPAEDALGYGFGAHRCIAEHLAKT
ELTTVFATLFKELPDLKIAVPFEKINFTPLDRDVGVIDLPVTF
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcgtcagaacctccgagtttcccgttcaagagggcttctggaatggagcccccggct
gagtttgcgcgtttgcgagcctccgacccagtgtccaaggtcaagctgtttgatggcagt
cttgcgtggcttgtgaccaagtacaaggatgtcacgtttgttgcgaccgatgagaggctc
tccaaggtccgcacacgcaagggcttcccggagctaagcgccggcggcaagcaagctgcc
aaagccaagccgacttttgttgatatggatgctcccgaccacatgaagcagaggggtatg
gtggagcctctattcactcggaaacatgtcgagaagctgcagccgtacatccaaaagaca
gtcgatgatctcttggctgccatgaagaagaagggttgtgccactggccccgttgacctg
gttaaggagtttgcgctcccagtgccgtcatacatcatctacacgatccttggagtccct
ttcaacgacttggagtatcttacgaatcagaatgccatccgaacaaacggaagttccaca
gcccgagaagcctctgcagcaaacaaggagctccttgactacctggccagcttggttgac
aagcgtctcgaagcgcccgaggacgacatcatcagcaagctttgcagagaacaagtgaaa
cctggcaacattgaaaaggctgatgcagtgcaaattgcatttttacttctcgttgccggc
aatgccactatggtgaacatgattgcgctgggagttgttaccttgttccagcacccagag
caactggcgaagctaaaggaaaacccatcactggctcctcagttcgtcgaagaactatgt
cgatatcacacagcttcagctctcgctatcaagcgaactgccaaggttgacctcgaaatt
ggcggcaagcatatcaaggcaaacgaaggcatcattgcctcaaatcaatccgccaaccgc
gatgcagacatctttgagaaccccgatgagtttaacatgaaccgaaggtggcctgctgag
gatgctcttggctacggatttggtgcccatcgatgcattgccgagcatctcgctaaaacg
gaactgactacggtgtttgccacgctgttcaaggagttacccgatcttaagattgctgtg
ccctttgaaaagatcaactttactccgctggacagagatgttggcgtgattgacttgccg
gtcacattctga

DBGET integrated database retrieval system