KEGG   Natronosporangium hydrolyticum: JQS43_06215
Entry
JQS43_06215       CDS       T07914                                 
Name
(GenBank) aromatase/cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
nhy  Natronosporangium hydrolyticum
Pathway
nhy01056  Biosynthesis of type II polyketide backbone
nhy01100  Metabolic pathways
nhy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    JQS43_06215
Enzymes [BR:nhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     JQS43_06215
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: QSB15923
UniProt: A0A895YKV2
LinkDB
Position
complement(1357326..1358270)
AA seq 314 aa
MSTSPHREVEHEIVIAAPASKVYRLIAEVENWPQLFPPTIFVDHIERSDRSERIRIWALA
NGQAKTWTSRRELDPTSLRITFRQEVSAHPVAAMGGAWYFEALTPDETRVRLLHDYRAVN
DEPTDLAWIDEAVDRNSQAELVALKSIAETAEETAELTFAFTDTVQVDGSVKDVFDFINQ
AERWTERLPHVAAVTLAEEQPGVQTLEMTTRAKNGSTHLTKSYRVTFPHQRIAYKQVTLP
ALLAVHTGIWTFTENGSGVAASSQHTVVLNPTNIAHVLGPDADVAQARSYVRNALSSNSL
ATLEHARTYAEQHR
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtccacgtcacctcaccgcgaggttgagcacgagatcgtcatcgccgcgccggccagt
aaggtctaccgcttgatcgccgaggtagagaactggccacaactctttccacctacgatc
ttcgtggatcatatcgaacgcagcgaccgcagtgagcggatccgtatctgggcgctcgcc
aacggccaggcgaagacctggacctcccgccgggagttggacccgacgagcctgcggatc
accttccgacaggaggtttcggcgcacccggtcgccgctatgggcggtgcctggtatttc
gaagccctcacgcccgacgagaccagggttcggctactccacgactaccgggcggtcaac
gatgagccgaccgacctcgcgtggatcgacgaagcggtcgaccggaactcacaggccgag
ttggtcgccctcaagagtatcgccgagaccgccgaggagaccgccgaattgaccttcgcc
ttcaccgacacagtccaggtcgacggctccgtaaaggacgtcttcgacttcatcaaccag
gccgagcgatggactgagcgattgccgcacgtcgccgcggtgacgctcgcagaggagcaa
cccggggtgcagaccctggagatgaccacccgggcgaagaatggctccacccacctcacg
aagtcataccgagtgaccttcccgcatcagcggatcgcctacaagcaggtaaccctgccg
gcgctgctggccgtccacactggcatctggacgttcaccgaaaacgggtccggggtcgcc
gcctcatcccagcacaccgtggtgctcaaccccaccaacatagcccacgtactcggaccg
gacgccgacgtggcgcaggcccgcagctacgtacgcaacgcgttgagcagcaacagcctc
gccacgctcgagcacgcccgcacgtacgctgaacagcatcgctaa

DBGET integrated database retrieval system