KEGG   Nocardia iowensis: KV110_23630
Entry
KV110_23630       CDS       T07470                                 

Name
(GenBank) hypothetical protein
  KO
K04340  scyllo-inosamine-4-phosphate amidinotransferase 1 [EC:2.1.4.2]
Organism
nie  Nocardia iowensis
Pathway
nie00521  Streptomycin biosynthesis
nie01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nie00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KV110_23630
Enzymes [BR:nie01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.2  scyllo-inosamine-4-phosphate amidinotransferase
     KV110_23630
SSDB
Other DBs
NCBI-ProteinID: QXN88585
LinkDB
Position
complement(5147016..5148080)
AA seq 354 aa
MSTHNEWDPLEEVVIGTPYHLDYHNDRSFRIFFHTNRSTINTDGDMRKVRPSNQMKEECL
EDIADLIKIMDDFRVTVRRPEVSEQVPVVQSPYWKAPMGHALMSRDIFLVIGNEIIETSP
MMRARYFEPELYKELFTEYFNKGAKWTVAPKSRLLDHNFDTGFLQELGFEEEAPQQPFYE
IMFDGAQVMRLGRDLVFNASSENHRMGARWLKQHLGDEYRVHLTNITDTHIDGEVLPLRP
GVLLARDTVDIDLLPAPMRNWDVIRYSWLDRPLEIAQDGVPLLASQTIGMNVLSLDQEHV
VVQDIQEPLMRDLEKHGFTPVPCRWRHGRSLGGGFHCVTLDIRRSGGLEDYFSD
NT seq 1065 nt   +upstreamnt  +downstreamnt
gtgagtacccataacgaatgggatccactggaggaagtcgtcatcgggaccccctatcac
ctcgattaccacaacgaccgctcattccgaatcttcttccacacgaatcggtcgaccatc
aacaccgacggcgacatgcggaaagtccgcccgtcgaaccagatgaaggaagaatgtctg
gaggacatcgccgatctgataaagatcatggacgacttccgggtgacggtccggcggccg
gaagtctctgagcaggttccggtggtgcagtcgccgtactggaaagctccgatggggcat
gcgctgatgagccgagacatctttctggtgatcggcaatgaaatcatcgagacctcgccg
atgatgcgagcccgctacttcgagcccgaactctacaaagagctgttcacggagtatttc
aacaaaggcgcgaagtggacggtggcgcccaagtcacgcctgctggaccacaacttcgac
accggtttcctgcaggagttggggttcgaggaggaggcgccgcagcagccgttctacgag
atcatgttcgacggcgcccaggtgatgcggctcggtcgggacctggtattcaacgcctcg
tcggagaaccaccgaatgggtgcgcggtggctcaagcagcacctcggtgatgagtaccgg
gtgcatctcacaaatatcaccgacacgcatatcgacggtgaggtattgccgttgcgtccg
ggtgttctactcgcccgcgacaccgtcgacatcgatctgctgcccgcgcccatgcggaat
tgggatgtcattcgatactcgtggttggatcggccgctcgagatcgcccaggacggcgtc
ccgctgctggcatcccagacgatcgggatgaatgtcctctcgctcgaccaggaacacgtg
gtggtccaagacattcaggaaccgctgatgcgggacctcgagaaacacggtttcaccccg
gtgccgtgccggtggcggcacggtcgcagtctcggcggtggcttccactgcgtgaccctc
gacattcgccgtagtggcgggctcgaggattatttctcggattga

DBGET integrated database retrieval system