KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100579827
Entry
100579827         CDS       T03265                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04927  Cortisol synthesis and secretion
nle04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:nle00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100579827 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100579827 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 100579827
NCBI-ProteinID: XP_003263906
Ensembl: ENSNLEG00000003671
UniProt: G1QU03
LinkDB
Position
25:17686664..17715062
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPHMRNGPKHHQTCPWSHSLNLHLCIQKCLLRHREPLGTSQAQASSVEPGSRTGPD
HPLRQESSSTLPLGVFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaatgcctctgccccatactacagctacgaatactacctggactat
ctggacctcattcctgtggacgagaagaagctgaaagctcacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtccggctccccacacatgaggaacggccccaagcaccaccaaacatgcccctgg
agtcacagcctcaacctccacctgtgcatccagaagtgcctgctgcgccacagggaaccc
ctggggacctcacaggctcaggcaagctcagtggagccagggagcagaactggccctgac
catccgctacgacaggagagctcctccaccttgcccctcggggttttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system