KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591599
Entry
100591599         CDS       T03265                                 
Name
(RefSeq) cytochrome P450 3A5
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00140  Steroid hormone biosynthesis
nle00830  Retinol metabolism
nle00980  Metabolism of xenobiotics by cytochrome P450
nle00982  Drug metabolism - cytochrome P450
nle01100  Metabolic pathways
nle05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100591599
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100591599
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100591599
   00982 Drug metabolism - cytochrome P450
    100591599
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100591599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nle00199]
    100591599
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100591599
Cytochrome P450 [BR:nle00199]
 Cytochrome P450, animal type
  CYP3 family
   100591599
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 100591599
NCBI-ProteinID: XP_003278110
Ensembl: ENSNLEG00000035706
UniProt: G1RKB3
LinkDB
Position
17:complement(34288958..34321133)
AA seq 502 aa
MDLIPNLALETWVLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTKCYKKYGKMWGTYDGQLPVLAITDPDMIKTVLVKECHSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESIKKFLKFDFLDPLFLSIILFPFLTPVFEALNVSL
FPKDAINFLNKSVNRMKKSRLNDKQKHRPDFLQLMIDSQNLKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPIAIRLERTCKKDVEINGVFIPKGAMVVIPTYALHHDPKHWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLGMQG
LLQPEKPIVLKVDSRDGTLSGE
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcgctggaaacctgggttctcctggctgtcagcctggtg
ctcctctatctatatgggacccgtacacatggactttttaagagactgggaattccaggg
cccacacctctgcctttgttaggaaatgttttgtcctatcgtcagggtctctggaaattt
gacacaaaatgttataaaaagtatggaaaaatgtggggaacgtatgatggtcaactccct
gtgctggccatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgtcactct
gtcttcacaaatcgaaggtctttaggcccagtgggatttatgaaaagtgccatctcttta
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagtgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtactggtgagaaacttg
aggcgggaagcggagaaaggcaagcctgtcaccctgaaagacatctttggggcctacagc
atggatgtgatcactggcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaagcattaagaagttcctaaaatttgatttcttagatccattattt
ctctcaataatactctttccattccttaccccagtttttgaagcattaaatgtctctttg
tttccaaaagatgctataaattttttaaataaatctgtaaacagaatgaagaaaagtcgc
ctcaacgacaaacaaaagcaccgaccggatttccttcagctgatgattgactcccagaat
ttgaaagaaactgagtcccacaaagctctgtctgatctggagcttgtggcccagtcaata
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactttatatgaa
ctggccactcaccctgatgtccagcagaaactgcagaaggagattgatgcagttttgccc
aataaggcaccacctacctatgatgccgtggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccaattgctattagacttgagaggacctgcaagaaagat
gttgaaatcaatggggtattcattcccaaaggggcaatggtggtgattccaacctatgct
cttcaccatgacccaaagcactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaaggacagcatagatccttacatatacacaccctttggaactggacccagaaac
tgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtccttcag
aacttctccttcaaaccttgtaaagaaacacagatccccttgaaattaggcatgcaagga
cttcttcaaccagaaaagcccattgttctaaaggttgattcaagagatggaaccctaagt
ggagaatga

DBGET integrated database retrieval system