KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595603
Entry
100595603         CDS       T03265                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04610  Complement and coagulation cascades
nle04810  Regulation of actin cytoskeleton
nle05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100595603 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100595603 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100595603 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:nle04515]
    100595603 (ITGAX)
   04090 CD molecules [BR:nle04090]
    100595603 (ITGAX)
Cell adhesion molecules [BR:nle04515]
 Integrins
  Integrin alpha subunits
   100595603 (ITGAX)
CD molecules [BR:nle04090]
 Proteins
  100595603 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha FG-GAP_3 VWA_CoxE
Other DBs
NCBI-GeneID: 100595603
NCBI-ProteinID: XP_030653636
Ensembl: ENSNLEG00000016300
LinkDB
Position
2:complement(74646617..74698411)
AA seq 1154 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFHVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPLEAVNMSLGLSLAATTSPSQLLACGPTVHHACGRNM
YLTGLCFLLAAAQLTQRLPASRQECPRQEQDIVFLIDGSGSISSGNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNRFETHFTFEKFRRSSNPLSLLASVRQLGGLTYTATAIQKVVHQLF
HASYGARRDATKILIVITDGKKEGDSLDYKHVIPMADAAGIIRYAIGVGSAFQNTNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVMGTQIGSYFGASLCSMDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVA
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVQVSMKFIPAEIPRSVFECREQVVSDQILGQSSICLYIDT
SSKNLLRSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLETHCENFNLLLP
TCVEDSVTPITLRLNFTLMGKPLPAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDD
LGISFSFPGLKTLLVGSNLELNTEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQRQ
LRSLRLTCDSAPAGSQGTWSTSCRINHLVFRGGAQITFVATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTSFQLELPVKYAVYAVASSHEQFTKYLNFSESEEKESRVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLWCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFNTSVYS
QLPGQEAFMRAQTTTVVEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagctctcctcctgttcacagccttagcgacttctctaggtttc
aacttggacacagaggagctgacagccttccatgtggacagtgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagcccctcaaaagataacagctgcc
aaccaaacgggtggcctctaccagtgtggctacagcaccggtgcctgtgagcccatcggc
ctgcaggtccccctggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agcccttcccagctgctggcctgcggccccacagtgcaccacgcgtgcggcaggaacatg
tacctgaccggactctgcttcctcctggccgccgcccagctcacccagaggctcccagcg
tccaggcaggagtgcccaagacaggagcaggatattgtgttcctgatcgatggctcaggc
agcatctcctccggcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccaaccgattcgaaacacac
ttcactttcgagaaattcaggcgcagctcaaaccccctcagcctgttggcttctgttcgc
cagctgggagggttaacatacacggccaccgccatccaaaaagtcgtgcaccaattgttc
catgcctcatatggggcccgtagagatgccaccaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataagcatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggatcagcttttcaaaacacaaattcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccaactgaaggagaagatctttgccattgagggtacggag
accacaagcagtagctccttcgaattggagatggcacaggagggcttcagcgctgtgttc
acgcctgatggccccgttctgggggccgtggggagcttcacttggtctggaggcgccttc
ctgtaccccccaaatatgagccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggccctctggaaaggggtgcagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcaatggaggatgaaagccgaagtcatggggacccagatcggctcctacttcggggct
tccctctgctccatggatgtggacagcgacggcagcaccgacctggtcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctctacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacggacgtggcc
atcggggccccaggagaggaggagaaccggggtgctgtctacctgtttcacggagtcttg
ggacccagcatcagcccctcccacagccagcggatcgccggctcccagctctcctccagg
ctgcagtattttgggcaggctctgagtgggggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccgaggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgcaggtgagcatgaagttcatacctgctgagatccccaggtctgtgtttgagtgtcgg
gagcaggtggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaca
agttccaagaacctgcttaggagccgtgacctccaaagctctgtgaccttggacctggcc
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagttcgagtcctcgggctggagacacattgtgaaaacttcaacctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctgatgggc
aagcccctccctgccttcagaaaccttcggcctatgctggccgccgatgctcagagatac
ttcacggcctccctaccctttgagaagaactgtggagctgaccatatctgccaggacgat
ctcggcatctccttcagcttcccaggcttgaagaccctgctggtggggagtaacctggag
ctgaacacagaagtgatggtgtggaacgacggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgctacgtggcagagggccagaaacaaaggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagggcacctggagc
accagctgcagaatcaaccacctcgtcttccgtggcggtgcccagatcaccttcgtggct
acctttgacgtctcccccaaggctgtcctgggagacaggctgcttctgacagccaatgtg
agcagcgagaacaacactcccaggaccagcaagaccagcttccagctggagctcccggtg
aagtacgccgtctacgctgtggctagcagccacgaacaattcaccaagtacctcaacttc
tcagagtctgaggagaaggaaagccgtgtggccatgcacagataccaggtcaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggacgtggaggtctcccacccccagaacccatccctttggtgctcctca
gagaaaattgcacccccagcatctgacttcctggcgcacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacgtcccctccttcagtgtccag
gaggagctggatttcaccctgaagggcaacctcagctttggctgggtccgccagacatcg
cagaagaaggtgtccgttgtgagtgtggctgaaattacattcaacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtggtggagaagtac
aaggtccacaaccccacccccctcatcgtaggcagctccattgggggcctgctgctgctg
gcactcatcacagcggtactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacgggacatag

DBGET integrated database retrieval system